Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1363 IGR1366 IGR1370 IGR1369 IGR1368 IGR1365 IGR1364 IGR1367 sgaA, - HD1859 sgaH, - HD1857 HD1856 sgaT, - HD1860 deoR,glpR, - HD1863 HD1854 sgaU, - HD1864 HD1861 menD, - HD1853 sgaA, - HD1859 sgaH, - HD1857 HD1856 sgaT, - HD1860 deoR,glpR, - HD1863 HD1854 sgaU, - HD1864 HD1861 menD, - HD1853 sgaA, - HD1859 sgaH, - HD1857 HD1856 sgaT, - HD1860 deoR,glpR, - HD1863 HD1854 sgaU, - HD1864 HD1861 menD, - HD1853 araD, - HD1866 araD, - HD1866
* Calculated from Protein Sequence

Gene ID: HD1860

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
sgaT  

Definition:
carbohydrate transport protein SGAT

Gene Start:
1563008

Gene Stop:
1561191

Gene Length:
1818

Molecular Weight*:
65845

pI*:
8.70

Net Charge*:
6.89

EC:
2.7.1.69  

Functional Class:
Energy metabolism; Sugars  
Transport and binding proteins; Carbohydrates, organic alcohols, and acids  

Pathway: pathway table
Aminosugars metabolism
Fructose and mannose metabolism
Galactose metabolism
Glycolysis / Gluconeogenesis
Starch and sucrose metabolism

Secondary Evidence:
Reizer, J., Charbit, A., Reizer, A., and Saier, M. H. J. R.
Novel phosphotransferases system genes revealed by bacterial genome analysis: operons encoding homologues of sugar-specific permease domains of the phosphotransferase system and pentose catabolic enzymes.
Genome Sci. Technol. 1: 53-75, 1996.

Comment:


Blast Summary:  PSI-Blast Search
Residues 1-605 are 67% similar to 15602629 unknown [Pasteurella multocida].

Residues 1-472 are 72% similar to SGAT_ECOLI, a putative transport protein related to pentitol (see HD1859). C-terminal residues 512-604 are more weakly similar to SGAT_ECOLI but are 76% similar to PTXB_ECOLI. Residues 13-411 are 51% similar to SGAT_MYCPN. No apparent similarity to HAEIN.

HD1860 is similar to yjfS hypothetical protein from M. pneumoniae (MP0347). No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, or M. genitalium.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 13-438 are 75% similar to a (PROTEOME COMPLETE TRANSPORT MEMBRANE) protein domain (PD043062) which is seen in Q9CMQ1_PASMU.

Residues 512-604 are 59% similar to a (PHOSPHOTRANSFERASE PROTEOME COMPLETE B) protein domain (PD068164) which is seen in Q9CMQ1_PASMU.



Paralogs:  Local Blast Search
HD1860 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 5 to 430 (E-value = 1.7e-240) place HD1860 in the SgaT_UlaA family which is described as Putative sugar-specific permease, SgaT/UlaA (PF04215)
Residues 513 to 602 (E-value = 8.4e-27) place HD1860 in the PTS_IIB family which is described as PTS system, Lactose/Cellobiose specific IIB subunit (PF02302)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MDTLMSIFMAINDQILSKAPLLLGLVACIGYIFLKKDSTTILKGTIKTIV
GFMLVQVGSGTLVQNFKPVIEGLSKYHNLKGAVIDPYTSWQATISTMGDG
YAYVGYAVILALFLNILLVLFRRITGIRTIMLTGHIMFQQAGLIAVIFWV
LNAKPWEIVIYTAIIMALYWGIFSNMMYQATQQVTGGAGFSIGHQQQFAS
WLAAKIAPKLGNKEQTVDKLNLPKWLHIFHDSISATAIVMTVFFGIILLS
FGLDNLQQMAGKTHWSIYIIETGLKFAVAIQVIVLGVRMFVAELSESFKG
ISERLIPNAVLAIDCAATYAFSPNAVVFGFMWGAIGQFLAVGALIVYQQF
GGDASPAVLIIPGFIPMFFSNATIGVFANHFGGWKAVMKICFVMGIIEVL
GSAWVVSLITSTDAGAGFNGWMGMADWALLFPPIIQAMFFSPQGATFLVI
LLSLIYMAFAGKQLRADEARAKAEGKTVDQLYGFGEPQVEQTTLETSASQ
STEAGNEGAKVVRILAVCGSGQGSSMMMKMKIKQYLDKRSIPNIMDSCAV
TDHKGKVNSVDIIVCSKHLQGEIVQDGRVSVLGVQNMLNPNSFGDELLAL
IKKYQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATACATTAATGAGTATCTTTATGGCGATTAATGACCAAATTCTATC
TAAAGCTCCATTATTATTAGGTTTGGTTGCTTGTATTGGTTATATTTTTC
TTAAGAAAGATTCAACCACAATTTTGAAAGGTACGATTAAAACTATTGTT
GGTTTTATGTTAGTACAAGTGGGATCAGGTACATTGGTACAAAATTTTAA
GCCCGTGATTGAAGGCTTATCTAAATACCATAATTTGAAAGGCGCGGTAA
TTGATCCTTATACTAGCTGGCAAGCCACCATTAGCACAATGGGAGATGGT
TATGCTTATGTTGGTTATGCGGTTATTTTGGCGTTATTCCTTAATATTTT
ATTAGTACTATTCCGGCGGATAACTGGCATACGTACAATTATGCTAACCG
GCCATATTATGTTCCAACAGGCTGGCTTGATAGCGGTTATTTTCTGGGTG
TTAAATGCGAAACCTTGGGAAATTGTTATTTATACCGCGATTATTATGGC
GTTATATTGGGGTATTTTCTCCAATATGATGTATCAAGCTACTCAGCAAG
TGACTGGCGGTGCAGGTTTCTCTATTGGTCACCAACAACAATTTGCTTCT
TGGCTAGCGGCTAAAATTGCTCCTAAATTGGGTAATAAGGAACAAACGGT
TGATAAATTAAACTTGCCAAAATGGTTACATATTTTCCACGATAGTATTT
CAGCAACGGCTATTGTGATGACCGTTTTCTTTGGCATTATTTTATTATCA
TTTGGTTTAGATAATTTACAACAAATGGCGGGTAAAACGCATTGGTCCAT
TTATATTATTGAGACTGGATTGAAATTTGCAGTAGCGATTCAAGTGATTG
TTTTAGGTGTACGAATGTTTGTCGCAGAGTTATCTGAATCATTTAAAGGT
ATTTCTGAACGTTTAATTCCAAATGCAGTATTAGCGATTGACTGTGCTGC
TACTTATGCTTTTTCACCTAATGCGGTGGTATTTGGTTTTATGTGGGGCG
CAATTGGTCAATTTTTAGCGGTTGGTGCTTTAATTGTGTATCAACAATTT
GGCGGTGATGCTTCTCCAGCAGTGTTAATTATTCCGGGCTTTATCCCAAT
GTTCTTCTCCAATGCGACCATTGGTGTCTTTGCTAACCATTTTGGTGGTT
GGAAAGCGGTAATGAAAATTTGTTTTGTGATGGGAATTATTGAAGTGCTT
GGTTCTGCTTGGGTGGTGAGTCTAATCACTTCAACCGATGCTGGCGCAGG
TTTTAATGGCTGGATGGGAATGGCAGACTGGGCATTATTGTTCCCGCCAA
TTATTCAAGCGATGTTTTTTAGCCCACAAGGTGCGACATTCTTAGTTATT
TTATTATCCTTAATCTATATGGCGTTTGCGGGTAAACAGCTACGCGCTGA
TGAAGCACGTGCGAAAGCAGAAGGTAAAACTGTCGATCAATTATACGGAT
TTGGTGAGCCTCAGGTAGAACAAACTACGCTTGAAACGAGCGCTTCTCAA
TCAACAGAAGCGGGTAATGAAGGCGCAAAAGTTGTCCGTATTTTGGCAGT
ATGTGGTTCGGGACAAGGTTCATCTATGATGATGAAAATGAAGATTAAAC
AGTATTTAGACAAAAGATCTATTCCAAACATAATGGATTCTTGTGCAGTG
ACTGACCATAAAGGTAAGGTAAATAGTGTTGATATCATTGTTTGCTCTAA
ACATTTACAAGGTGAGATTGTGCAAGACGGTCGAGTCTCTGTGCTTGGTG
TTCAAAATATGTTGAATCCAAATTCATTTGGCGATGAATTGTTGGCATTA
ATCAAAAAATATCAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy