Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1363 IGR1366 IGR1369 IGR1368 IGR1365 IGR1364 IGR1362 IGR1367 sgaA, - HD1859 sgaH, - HD1857 HD1856 sgaT, - HD1860 deoR,glpR, - HD1863 HD1854 sgaU, - HD1864 HD1861 menD, - HD1853 sgaA, - HD1859 sgaH, - HD1857 HD1856 sgaT, - HD1860 deoR,glpR, - HD1863 HD1854 sgaU, - HD1864 HD1861 menD, - HD1853 sgaA, - HD1859 sgaH, - HD1857 HD1856 sgaT, - HD1860 deoR,glpR, - HD1863 HD1854 sgaU, - HD1864 HD1861 menD, - HD1853
* Calculated from Protein Sequence

Gene ID: HD1859

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
sgaA  

Definition:
PTS system Enzyme II-A permease component

Gene Start:
1561122

Gene Stop:
1560655

Gene Length:
468

Molecular Weight*:
16763

pI*:
4.10

Net Charge*:
-16.32

EC:
2.7.1.69  

Functional Class:
Transport and binding proteins; PTS system  

Pathway: pathway table
Aminosugars metabolism
Fructose and mannose metabolism
Galactose metabolism
Glycolysis / Gluconeogenesis
Starch and sucrose metabolism

Secondary Evidence:
Reizer,J., Charbit,A., Reizer,A. and Saier,M.H.Jr.
Novel phosphotransferases system genes revealed by bacterial genome analysis: operons encoding homologues of sugar-specific permease domains of the phosphotransferase system and pentose catabolic enzymes. Genome Sci. Technol. 1, 53-75 (1996)

Comment:
For other PTS related genes, see HD0768 (ptnA), HD0585 (ptsN), HD0227, HD0766 (ptnD), HD0767 (ptnC).

Blast Summary:  PSI-Blast Search
Residues 2-155 are 66% similar to PTXA_ECOLI, a component of the E. coli phosphotransferase enzyme II system. Residues 10-126 are 55% similar to PTYA_ECOLI. Weaker similsrities to other PTS-EIIA-related proteins. Residues 7-136 are 47% similar to PTFA_HAEIN.

HD1859 is similar to yjfU hypothetical phosphotransferase protein from M. pneumoniae (MP0348). No similarities to C. trachomatis, C. pneumoniae, U. urealyticum, T. pallidum, or M. genitalium.

COGS Summary:  COGS Search
BeTs to 3 clades of COG1762
COG name: Phosphotransferase system mannitol/fructose-specific IIA domain (Ntr-type)
Functional Class: G,T
The phylogenetic pattern of COG1762 is --------EB-H--gPOLIN-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 12-149 are 33% similar to a (PHOSPHOTRANSFERASE SYSTEM ENZYME) protein domain (PD202753) which is seen in PTXA_MYCPN.

Residues 2-124 are 67% similar to a (COMPONENT SYSTEM PHOSPHOTRANSFERASE IIA ENZYME COMPLETE) protein domain (PD001689) which is seen in Q9CMQ0_PASMU.



Paralogs:  Local Blast Search
HD1859 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 5 to 152 (E-value = 1.6e-36) place HD1859 in the PTS_EIIA_2 family which is described as Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2 (PF00359)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MLKESLIENNSILLNQHVADWRAAIKLGTDLLEKAGAIEARYYTNIVSKI
EEMGPYIILAPGLAMPHARPEEGVIKTSFALVTLAEPVYFDGEDEPVSVL
ITLAGSDSDQHMEGLMEVTQILDDAESDSGVNLDKVLACKTAEEIYAMID
ASLGA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTAAAAGAATCATTGATTGAAAATAATTCGATTCTACTTAATCAGCA
CGTGGCGGATTGGAGAGCAGCAATTAAGCTAGGTACGGATTTATTAGAAA
AAGCGGGAGCAATTGAAGCTCGTTATTATACAAATATTGTCAGTAAAATT
GAGGAAATGGGGCCTTATATTATTTTAGCACCTGGCTTAGCAATGCCTCA
TGCAAGGCCTGAAGAAGGTGTTATTAAAACCTCATTTGCTTTAGTTACTT
TAGCAGAACCTGTGTATTTTGATGGTGAAGATGAGCCTGTTTCGGTATTA
ATTACTTTAGCAGGAAGTGATTCTGATCAACATATGGAAGGTTTAATGGA
AGTCACTCAAATTCTAGATGATGCAGAGAGTGATAGCGGTGTGAATCTTG
ATAAAGTGTTGGCGTGTAAAACGGCGGAAGAGATTTACGCTATGATTGAT
GCGTCGTTAGGCGCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy