Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1363 IGR1366 IGR1368 IGR1365 IGR1364 IGR1362 IGR1367 sgaA, - HD1859 sgaH, - HD1857 HD1852 HD1856 sgaT, - HD1860 deoR,glpR, - HD1863 HD1854 HD1861 menD, - HD1853 sgaA, - HD1859 sgaH, - HD1857 HD1852 HD1856 sgaT, - HD1860 deoR,glpR, - HD1863 HD1854 HD1861 menD, - HD1853 sgaA, - HD1859 sgaH, - HD1857 HD1852 HD1856 sgaT, - HD1860 deoR,glpR, - HD1863 HD1854 HD1861 menD, - HD1853
* Calculated from Protein Sequence

Gene ID: HD1857

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
sgaH  

Definition:
hexulose-6-phosphate synthase

Gene Start:
1560514

Gene Stop:
1559834

Gene Length:
681

Molecular Weight*:
24479

pI*:
6.50

Net Charge*:
-1.74

EC:
 

Functional Class:
Energy metabolism; Sugars  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Several significant hits in gapped BLAST to probable hexulose-6-phosphate synthases; e.g., residues 1-225 are 61% similar to SGBH_HAEIN [1176355], a putative hexulose-6-phosphate synthase (D-arabino 3-hexulose 6-phosphate formaldehyde lyase) and member of the HUMPS family. Residues 1-225 are also 46% similar to SGBH_ECOLI [586720], 39% similar to SGAH_ECOLI [732030], and 37% similar to SGAH_MYCPN [2495434].

COGS Summary:  COGS Search
BeTs to 7 clades of COG0269
COG name: 3-hexulose-6-phosphate synthase and related proteins
Functional Class: G
The phylogenetic pattern of COG0269 is Amtk----Eb-h---p-----
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 110-225 are 74% similar to a (LYASE PROTEOME HUMPS HEXULOSE-6-PHOSPHATE) protein domain (PD016483) which is seen in Q9CMP9_PASMU.

Residues 6-215 are 64% similar to a (DECARBOXYLASE LYASE SYNTHASE PYRIMIDINE BIOSYNTHESIS) protein domain (PD001042) which is seen in Q9CLI4_PASMU.



Paralogs:  Local Blast Search
HD1857 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 4 to 217 (E-value = 4.9e-50) place HD1857 in the OMPdecase family which is described as Orotidine 5'-phosphate decarboxylase / HUMPS family (PF00215)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MSKPLLQIALDSLSLETAVADAKQAESVVDIIECGTILACAEGMKAVKTL
RALHPNHIIVCDLKTTDGGAILAKMAFEAGADWLTVSAAAHSATKAACKK
VADEFNAAHPELKVKKEIQIEIYGNWTVEKDVQEWLDLGVTQAIYHRSRD
AELAGKSWTAEDIELMQQLSQKGLALSITGGIVPEDIHLFKTVKNAKAFI
SGRALVGEKGKQTAKAIRAEIDKYWQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCAAAACCATTACTGCAAATCGCACTTGATTCATTAAGTTTAGAAAC
AGCCGTGGCAGATGCTAAACAAGCAGAAAGTGTAGTAGATATTATTGAAT
GTGGCACTATTTTAGCTTGTGCAGAAGGCATGAAAGCGGTCAAAACATTA
CGTGCATTACACCCAAATCATATTATTGTGTGCGATTTAAAAACGACAGA
TGGTGGGGCGATTTTAGCCAAAATGGCATTTGAAGCCGGTGCAGATTGGT
TGACGGTTTCTGCGGCAGCACACTCTGCCACTAAAGCGGCTTGTAAAAAA
GTAGCGGATGAATTTAATGCTGCGCATCCAGAATTAAAAGTCAAAAAAGA
AATTCAGATTGAAATTTATGGCAATTGGACGGTTGAAAAAGACGTGCAAG
AATGGCTAGATTTGGGCGTAACACAAGCGATTTATCACCGTTCACGTGAT
GCAGAATTAGCTGGTAAAAGTTGGACAGCAGAAGATATTGAATTAATGCA
ACAATTGTCTCAAAAAGGATTAGCGCTATCTATTACGGGCGGTATTGTGC
CAGAAGACATTCATTTATTTAAAACTGTCAAAAATGCCAAAGCCTTTATT
TCAGGTCGAGCATTAGTTGGCGAAAAAGGTAAGCAAACGGCTAAAGCGAT
TCGCGCCGAAATTGATAAATATTGGCAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy