Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1363 IGR1366 IGR1365 IGR1364 IGR1361 IGR1362 IGR1367 sgaA, - HD1859 sgaH, - HD1857 HD1852 nanA, - HD1850 HD1856 sgaT, - HD1860 HD1854 HD1861 menD, - HD1853 sgaA, - HD1859 sgaH, - HD1857 HD1852 nanA, - HD1850 HD1856 sgaT, - HD1860 HD1854 HD1861 menD, - HD1853 sgaA, - HD1859 sgaH, - HD1857 HD1852 nanA, - HD1850 HD1856 sgaT, - HD1860 HD1854 HD1861 menD, - HD1853
* Calculated from Protein Sequence

Gene ID: HD1856

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
hypothetical protein

Gene Start:
1559623

Gene Stop:
1558658

Gene Length:
966

Molecular Weight*:
37983

pI*:
10.40

Net Charge*:
15.41

EC:
 

Functional Class:
Hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No hits to any protein.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search

HD1856 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MKKLSIITVTLVTIVSSTIWAKDVNENSSADYYHQHIKNKLNRLSNEING
WLGETDPNQPASAMLWVMLDTEWNRYGGVTYKPRVRGKVRLPVLQKHLRM
IFGDEELDYNNRDKNRRGNNYDQALKKYKKYDRHQVRRDNNALGLNWSDG
IERLGIDTDFDVGLRAGTDLYGRLRLVKEWTWQSIPQYSTKLEQIYRYGR
KSKHYLHTNLGNKWQENEETFINNHTFLEYTKQDTESLIWGNSLHREHNW
ANYKRLSYGIYAGGSLNKQNAKLNSYGPFITYRQPILSNWLFIQPEVSFY
NNKDQKKSHFINAFVRLEAVF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAGTTATCTATTATTACCGTAACGCTTGTTACTATCGTCTCATC
AACTATTTGGGCGAAAGACGTTAATGAAAATAGTTCGGCAGATTATTATC
ACCAACATATAAAAAATAAATTAAATCGTTTGTCGAATGAAATTAATGGT
TGGTTAGGTGAAACAGATCCTAATCAGCCTGCTTCAGCGATGTTATGGGT
AATGTTAGATACGGAGTGGAATAGATATGGTGGCGTAACATATAAACCAC
GTGTTCGTGGTAAAGTGCGGTTACCGGTTTTACAAAAACATTTGCGAATG
ATTTTTGGTGATGAAGAATTAGATTATAACAATCGTGATAAAAATCGGCG
TGGCAATAATTATGATCAAGCTTTAAAAAAGTATAAAAAATATGATCGTC
ACCAAGTACGCCGAGATAATAATGCTCTTGGTTTGAATTGGAGTGATGGT
ATTGAGCGTTTAGGCATTGACACGGATTTTGATGTTGGGCTTCGTGCTGG
GACGGATCTTTATGGCCGGTTACGATTAGTGAAAGAATGGACGTGGCAAT
CAATTCCACAATATAGTACGAAACTAGAACAAATTTACCGCTATGGTAGA
AAAAGTAAGCATTATCTTCATACAAATTTAGGGAATAAGTGGCAAGAAAA
CGAGGAAACCTTTATTAATAACCACACTTTCTTAGAATATACTAAACAGG
ATACGGAATCACTCATTTGGGGTAATAGTTTACACCGTGAACATAACTGG
GCAAATTATAAACGTTTAAGTTATGGTATTTATGCCGGCGGCAGTTTAAA
TAAACAGAATGCCAAATTGAATAGTTATGGGCCTTTTATTACCTATCGGC
AGCCTATTTTAAGTAATTGGTTGTTTATTCAGCCAGAAGTGAGTTTTTAT
AATAATAAGGATCAGAAAAAATCTCACTTTATTAATGCGTTTGTCCGTTT
AGAAGCGGTCTTTTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy