Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1363 IGR1366 IGR1360 IGR1365 IGR1364 IGR1361 IGR1362 IGR1367 sgaA, - HD1859 sgaH, - HD1857 HD1852 nagB, - HD1847 nanA, - HD1850 HD1856 sgaT, - HD1860 HD1854 menD, - HD1853 sgaA, - HD1859 sgaH, - HD1857 HD1852 nagB, - HD1847 nanA, - HD1850 HD1856 sgaT, - HD1860 HD1854 menD, - HD1853 sgaA, - HD1859 sgaH, - HD1857 HD1852 nagB, - HD1847 nanA, - HD1850 HD1856 sgaT, - HD1860 nanA, - HD1849 nanA, - HD1849 HD1854 menD, - HD1853
* Calculated from Protein Sequence

Gene ID: HD1854

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
1557808

Gene Stop:
1558593

Gene Length:
786

Molecular Weight*:
29940

pI*:
9.70

Net Charge*:
7.26

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 19-257 are 45% similar to YFBB_HAEIN, a conserved hypothetical protein (HI0282). Residues 19-255 are 41% similar to YFBB_ECOLI, a hypothetical 26.7 kD protein in the menD-menB intergenic region, which is associated with Menaquinone (vitamin K2) biosynthesis.

COGS Summary:  COGS Search
BeTs to 3 clades of COG0596
COG name: Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily)
Functional Class: R
The phylogenetic pattern of COG0596 is A---Yq-CEBR-ujgp----X
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 86-253 are 26% similar to a (PROTEOME MENAQUINONE COMPLETE PATH) protein domain (PD415901) which is seen in Q9CHK1_LACLA.

Residues 116-249 are 49% similar to a (PROTEOME COMPLETE HYDROLASE PM0055) protein domain (PD013188) which is seen in YFBB_HAEIN.



Paralogs:  Local Blast Search

HD1854 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MLACQSHNTNTHNQITTPIIFLHGLLGSQADWQAVVTLLQKNPQIQPLTI
DLPAHGNSNKIISDDFITARQLIDQTIKQRLSHRPFYLVGYSLGGRIALD
YALNGNNPDLQHTFLEGTHLGLSLANERQARWQTDQQWANRFRNEPIKQV
LQAWYQQPVFADLSAEKRSFLLEKRQHNNGHAIAQMLEATSLAKQPNYLS
TVKTQIHRFTFLIGERDHKFRQLATQQQLNYQLIRHAGHNSHQENPSDFV
ETLLQKITCIT$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTAGCTTGTCAATCGCATAATACGAACACACATAACCAAATTACAAC
ACCTATTATTTTTTTACATGGTTTATTAGGTTCACAAGCCGATTGGCAAG
CAGTGGTTACACTTTTACAAAAAAATCCTCAAATTCAACCGCTTACCATT
GATTTACCTGCACACGGTAACAGTAATAAGATCATATCTGATGATTTTAT
TACTGCACGACAATTAATTGATCAAACGATTAAACAACGACTTTCTCACC
GCCCATTTTATTTGGTTGGTTATTCTCTTGGCGGTCGCATAGCATTAGAT
TATGCACTGAATGGCAATAACCCTGACTTGCAACATACCTTTCTCGAAGG
CACTCATTTAGGTTTAAGTTTAGCGAATGAACGTCAAGCACGTTGGCAAA
CTGATCAACAATGGGCAAACCGTTTTCGAAATGAGCCGATCAAACAAGTA
TTACAGGCTTGGTATCAACAACCTGTCTTTGCTGATTTAAGTGCAGAAAA
GCGGTCATTTTTATTGGAAAAACGCCAACATAATAACGGCCACGCTATTG
CACAAATGCTAGAAGCCACCAGCTTAGCTAAACAGCCTAATTATCTCTCA
ACGGTTAAAACACAAATACACCGCTTTACTTTTTTGATCGGCGAGCGTGA
TCATAAATTTCGCCAGCTTGCTACACAACAACAACTTAACTATCAACTAA
TTCGCCATGCCGGCCATAATAGCCACCAAGAGAATCCTAGCGATTTTGTA
GAAACGTTGTTGCAAAAAATCACTTGCATCACATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy