Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1359 IGR1363 IGR1366 IGR1360 IGR1365 IGR1364 IGR1361 IGR1362 sgaA, - HD1859 sgaH, - HD1857 HD1852 nagB, - HD1847 nanA, - HD1850 HD1856 nagA, - HD1845 sgaT, - HD1860 HD1854 menD, - HD1853 sgaA, - HD1859 sgaH, - HD1857 HD1852 nagB, - HD1847 nanA, - HD1850 HD1856 nagA, - HD1845 sgaT, - HD1860 HD1854 menD, - HD1853 sgaA, - HD1859 sgaH, - HD1857 HD1852 nagB, - HD1847 nanA, - HD1850 HD1856 nagA, - HD1845 sgaT, - HD1860 nanA, - HD1849 nanA, - HD1849 HD1854 menD, - HD1853
* Calculated from Protein Sequence

Gene ID: HD1853

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
menD  

Definition:
2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase

Gene Start:
1556099

Gene Stop:
1557808

Gene Length:
1710

Molecular Weight*:
63114

pI*:
7.30

Net Charge*:
1.98

EC:
 

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Menaquinone and ubiquinone  

Pathway: pathway table

Secondary Evidence:
Saffarini DA, Blumerman SL, Mansoorabadi KJ.
Role of menaquinones in Fe(III) reduction by membrane fractions of Shewanella putrefaciens.
J Bacteriol. 2002 Feb;184(3):846-8.
PMID: 11790756

Comment:
0

Blast Summary:  PSI-Blast Search
Residues 5-568 are 63% similar to MEND_HAEIN, menaquinone biosynthesis protein menD (which includes 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (SHCHC synthase); 2-oxoglutarate decarboxylase (alpha-ketoglutarate decarboxylase [KDC]). Residues 5-564 are 47% similar to MEND_ECOLI.

COGS Summary:  COGS Search
BeTs to 4 clades of COG1165
COG name: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
Functional Class:  H
The phylogenetic pattern of COG1165 is -------cebrh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 290-564 are 66% similar to a (SYNTHASE PROTEOME COMPLETE DECARBOXYLASE) protein domain (PD011752) which is seen in Q9CPI4_PASMU.

Residues 14-176 are 65% similar to a (SYNTHASE THIAMINE PYROPHOSPHATE FLAVOPROTEIN LYASE) protein domain (PD000376) which is seen in Q9CPI4_PASMU.

Residues 96-176 are 46% similar to a (PROTEOME OXOGLUTARATE) protein domain (PD391154) which is seen in Q9KQM3_VIBCH.

Residues 281-377 are 69% similar to a (DECARBOXYLASE SYNTHASE KETOGLUTARATE) protein domain (PD283813) which is seen in MEND_HAEIN.

Residues 177-279 are 58% similar to a (SYNTHASE DECARBOXYLASE BIOSYNTHESIS) protein domain (PD137248) which is seen in MEND_HAEIN.



Paralogs:  Local Blast Search

HD1853 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MSTNSSFNRSWAKVILNALLRYGVKHFCIAPGSRSTPLTLEALQLQHTQQ
AECHSHFDERGLAFFALGMAKATNDPVAIIVTSGTAVANLYPALIEASLT
QHKLIVLSADRPPELIGCGVNQAITQPGIFADYPIANIHLPKASTDYNAS
WLAATIEQACVNQQQQGGVIHINAPFAEPLYETDENEINNTPWLKPLQSW
LIKPTAKWLNSQSIQSEVSMHENWDYWRTKRGVIIVGKLPVEQGVGIKAW
AETLGWCLLTDIQSCVDASLPYADIWLSNNTVHERLLNADIVIQFGSQII
SKRVNKYLADFKGEFWQVDEYQRYLNPFAHRQTRFVAKAHHFLRVHPPLR
QKPWLLEPLALSQFCASFIEQQVGGSLNEASLAHHIEQVLATNGNLFIGN
SLFVRLVDALCKLPEGYPVYTNRGASGIDGLIATMAGIAKASGQPTVGVV
GDISALHDLNSISLLSKINHPSILFVINNSGGAIFDMLPVEARVKEQFYR
LSHNYEFSQVAAMFGIEYIRPFTWADLKAKLKLAYGRKSATIVEIKVNDQ
DGSNLYKSLIKQISQAEIA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTACGAACAGTTCTTTCAATCGTTCTTGGGCAAAAGTTATTTTAAA
TGCCCTATTACGTTATGGTGTTAAACATTTTTGTATTGCGCCTGGTTCAC
GTTCCACACCGTTAACGCTTGAAGCACTTCAATTACAACACACTCAACAA
GCCGAATGCCATAGTCATTTTGATGAACGCGGCTTAGCGTTTTTTGCACT
CGGTATGGCAAAAGCAACCAACGATCCGGTTGCGATTATTGTGACTTCAG
GCACTGCCGTGGCTAATCTTTATCCTGCGTTAATTGAGGCCAGCCTTACA
CAACATAAACTGATTGTTCTTTCTGCTGATCGTCCACCTGAATTAATCGG
TTGTGGCGTTAACCAAGCAATCACACAACCGGGTATTTTTGCCGATTATC
CTATCGCGAATATTCATCTACCCAAAGCATCAACTGACTATAATGCAAGT
TGGTTAGCGGCCACTATCGAACAAGCTTGTGTTAATCAACAACAGCAAGG
CGGAGTAATTCATATTAACGCTCCTTTTGCCGAGCCCTTATACGAAACAG
ATGAAAACGAAATTAACAATACGCCATGGCTTAAACCATTACAAAGTTGG
TTAATTAAGCCAACAGCCAAATGGCTCAATAGTCAATCCATTCAAAGCGA
AGTATCAATGCACGAAAATTGGGACTATTGGCGCACTAAACGAGGCGTTA
TTATTGTGGGTAAATTGCCGGTTGAACAAGGCGTTGGCATAAAAGCGTGG
GCAGAAACATTAGGTTGGTGTTTATTAACGGATATACAATCTTGTGTTGA
TGCTAGTTTGCCTTATGCGGATATTTGGCTATCAAATAATACCGTACATG
AACGCCTATTAAACGCTGATATTGTTATTCAATTTGGCTCGCAGATTATT
AGTAAACGCGTTAACAAATATTTAGCGGATTTTAAAGGCGAATTTTGGCA
AGTAGATGAATATCAACGTTATCTTAATCCATTTGCACACCGTCAAACTC
GTTTTGTGGCTAAGGCACACCATTTCTTACGTGTTCATCCTCCATTACGG
CAAAAACCGTGGCTATTAGAACCGCTTGCTTTGTCACAATTCTGTGCTAG
CTTTATTGAACAGCAAGTAGGCGGAAGCTTAAATGAAGCCTCATTAGCGC
ATCATATTGAACAAGTTTTAGCGACTAACGGCAATTTATTTATTGGTAAT
AGTTTATTTGTAAGATTAGTTGATGCCTTATGTAAATTGCCTGAAGGTTA
CCCGGTTTACACAAACCGTGGTGCAAGTGGTATTGATGGCTTAATCGCCA
CTATGGCAGGCATCGCCAAAGCCAGTGGGCAACCGACCGTTGGTGTAGTA
GGTGATATTTCGGCTTTACACGATTTAAATTCAATTTCATTATTAAGCAA
AATAAACCACCCGTCTATCTTGTTTGTGATTAACAATAGTGGTGGTGCTA
TTTTTGATATGTTGCCTGTTGAAGCGCGTGTTAAAGAACAGTTTTACCGT
TTATCGCATAACTATGAATTTTCACAAGTGGCCGCCATGTTTGGCATTGA
GTATATCCGACCATTTACTTGGGCTGATTTAAAAGCTAAATTAAAATTAG
CCTATGGACGCAAAAGCGCCACTATTGTTGAAATCAAAGTGAATGATCAA
GATGGTAGCAATTTATATAAATCGTTAATTAAACAAATTTCGCAAGCGGA
AATTGCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy