Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1359 IGR1363 IGR1357 IGR1360 IGR1358 IGR1364 IGR1361 IGR1362 sgaH, - HD1857 HD1852 nagB, - HD1847 nanA, - HD1850 HD1856 wecA,rfe, - HD1844 wecB,rffE, - HD1843 nagA, - HD1845 HD1854 menD, - HD1853 sgaH, - HD1857 HD1852 nagB, - HD1847 nanA, - HD1850 HD1856 wecA,rfe, - HD1844 wecB,rffE, - HD1843 nagA, - HD1845 HD1854 menD, - HD1853 sgaH, - HD1857 HD1852 nagB, - HD1847 nanA, - HD1850 HD1856 wecA,rfe, - HD1844 wecB,rffE, - HD1843 nagA, - HD1845 nanA, - HD1849 nanA, - HD1849 HD1854 menD, - HD1853
* Calculated from Protein Sequence

Gene ID: HD1852

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
1555766

Gene Stop:
1555077

Gene Length:
690

Molecular Weight*:
23890

pI*:
4.60

Net Charge*:
-8.56

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Several significant hits in gapped BLAST to conserved hypothetical proteins; e.g., residues 1-228 are 63% similar to YHCJ_HAEIN, hypothetical protein HI0145 (2495664), residues 1-228 are 59% similar to conserved hypothetical protein AF237924 in Pasteurella multocida (7716509), and residues 1-227 are 49% similar to YHCJ_ECOLI, a hypothetical 24.1 kD protein (U18997) in the gltF-nanT intergenic region(F229) (1176200).

COGS Summary:  COGS Search
BeTs to 4 clades of COG0214
COG name: Predicted phosphate-utilizing enzyme involved in pyridoxine/purine/histidine biosynthesis
Functional Class: F,E
The phylogenetic pattern of COG0214 is amtkY-v--brh---------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 57-224 are 70% similar to a (COMPLETE PROTEOME PM1711 HI0145) protein domain (PD023458) which is seen in YHCJ_HAEIN.



Paralogs:  Local Blast Search

HD1852 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 35 to 226 (E-value = 2e-124) place HD1852 in the NanE family which is described as Putative N-acetylmannosamine-6-phosphate epimerase (PF04131)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MSKLSHSEVLIMIQGGLVVSCQPVDDGPMDQPAIVAAMAQAAIVGGAVGV
RIEGVQNLKATRPMVTAPIIAIVKRDLPESAVRITPFLADIDQLAAAGAD
IIAVDGTDRERPVAVVAALERIHAQGCLAMADCSTLAEGLYCQQLGFDII
GSTMSGYTGGELPVEPDYQLVKDLKSAGCYVMAEGRYNSPALAKSAMQMG
ADCVTVGSALTRLEHMVSWFAVAVQSAKE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCAAAATTATCGCATTCTGAAGTATTAATAATGATTCAAGGTGGCTT
AGTGGTCTCTTGTCAACCTGTAGATGATGGCCCTATGGATCAGCCCGCAA
TTGTGGCAGCTATGGCGCAAGCCGCAATTGTGGGGGGCGCAGTAGGAGTA
AGAATTGAAGGTGTGCAAAATTTAAAAGCAACGCGTCCAATGGTAACAGC
TCCGATTATCGCCATTGTAAAACGGGATTTACCAGAGAGCGCTGTACGGA
TTACGCCATTTTTAGCGGATATTGATCAATTAGCGGCCGCTGGTGCTGAT
ATTATCGCAGTAGATGGCACGGATAGAGAACGTCCGGTGGCTGTAGTTGC
CGCGTTGGAACGCATTCATGCCCAAGGTTGTTTAGCTATGGCAGACTGTT
CGACTTTAGCCGAAGGGCTATATTGTCAGCAATTAGGCTTCGATATTATT
GGCAGTACGATGTCTGGTTATACGGGAGGCGAATTGCCTGTGGAACCAGA
TTATCAATTAGTCAAAGATTTAAAATCTGCCGGTTGTTATGTGATGGCAG
AAGGTCGCTATAATTCCCCCGCATTGGCTAAAAGCGCGATGCAAATGGGC
GCAGACTGTGTAACAGTTGGATCAGCGTTAACACGGCTAGAACATATGGT
GAGTTGGTTTGCTGTTGCGGTGCAATCTGCTAAGGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy