Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1359 IGR1356 IGR1363 IGR1357 IGR1360 IGR1358 IGR1361 IGR1362 HD1852 nagB, - HD1847 nanA, - HD1850 HD1856 wecA,rfe, - HD1844 wecB,rffE, - HD1843 nagA, - HD1845 wecC, - HD1842 HD1854 menD, - HD1853 HD1852 nagB, - HD1847 nanA, - HD1850 HD1856 wecA,rfe, - HD1844 wecB,rffE, - HD1843 nagA, - HD1845 wecC, - HD1842 HD1854 menD, - HD1853 HD1852 nagB, - HD1847 nanA, - HD1850 HD1856 wecA,rfe, - HD1844 wecB,rffE, - HD1843 nagA, - HD1845 wecC, - HD1842 nanA, - HD1849 nanA, - HD1849 HD1854 menD, - HD1853
* Calculated from Protein Sequence

Gene ID: HD1849

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
nanA  

Definition:
N-acetylneuraminate lyase

Gene Start:
1554039

Gene Stop:
1553938

Gene Length:
102

Molecular Weight*:
3689

pI*:
11.20

Net Charge*:
4.93

EC:
4.1.3.3  

Functional Class:
Energy metabolism; Sugars  

Pathway: pathway table
Aminosugars metabolism

Comment:


Blast Summary:  PSI-Blast Search
Single weak hit in gapped BLAST to the C-terminal end of N-acetylneuraminate lyase (nanA) protein in H. influenzae (1573098); residues 1-33 are 69% similar to residues 260-292 of NPL_HAEIN.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search

HD1849 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
pdb|1F6P|A Chain A, Crystal Structure Analysis Of N-Acetylneura... 64 2e-012

Gene Protein Sequence:
LRALRRGYCREPMTAKATEQQLAVAKALKATFL$

Gene Nucleotide Sequence:  Sequence Viewer
TTGAGGGCGTTGAGGCGGGGGTATTGTCGTGAACCAATGACGGCGAAAGC
GACTGAACAGCAATTAGCGGTCGCAAAAGCATTGAAAGCAACATTTTTGT
AA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy