Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1359 IGR1356 IGR1357 IGR1360 IGR1358 IGR1361 IGR1362 HD1852 nagB, - HD1847 nanA, - HD1850 wecA,rfe, - HD1844 wecB,rffE, - HD1843 nagA, - HD1845 wecC, - HD1842 HD1854 menD, - HD1853 HD1852 nagB, - HD1847 nanA, - HD1850 wecA,rfe, - HD1844 wecB,rffE, - HD1843 nagA, - HD1845 wecC, - HD1842 HD1854 menD, - HD1853 HD1852 nagB, - HD1847 nanA, - HD1850 wecA,rfe, - HD1844 wecB,rffE, - HD1843 nagA, - HD1845 wecC, - HD1842 nanA, - HD1849 nanA, - HD1849 HD1854 menD, - HD1853
* Calculated from Protein Sequence

Gene ID: HD1847

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
nagB  

Definition:
glucosamine-6-phosphate isomerase

Gene Start:
1553844

Gene Stop:
1553041

Gene Length:
804

Molecular Weight*:
30126

pI*:
6.20

Net Charge*:
-4.73

EC:
5.3.1.10  

Functional Class:
Central intermediary metabolism; Amino sugars  

Pathway: pathway table
Aminosugars metabolism

Secondary Evidence:
Peri,K.G., Goldie,H. and Waygood,E.B.
Cloning and characterization of the N-acetylglucosamine operon of
Escherichia coli
Biochem. Cell Biol. 68 (1), 123-137 (1990)
MEDLINE: 90274974

Plumbridge J, Kolb A.
Nag repressor-operator interactions: protein-DNA contacts cover more than two turns of the DNA helix.
J Mol Biol. 1995 Jun 23;249(5):890-902.
PMID: 7791215

Vogler AP, Trentmann S, Lengeler JW.
Alternative route for biosynthesis of amino sugars in Escherichia coli K-12 mutants by means of a catabolic isomerase.
J Bacteriol. 1989 Dec;171(12):6586-92.
PMID: 2687246


Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to nagB proteins; e.g., residues 1-259 are 79% similar to NAGB_HAEIN; residues 1-263 are 71% similar to NAGB_ECOLI; and residues 1-258 are 62% similar to GNPI_HUMAN. Also significant similarity to other bacterial and eukaryotic nagB proteins.

COGS Summary:  COGS Search
BeTs to 6 clades of COG0363
COG name: Glucosamine-6-phosphate deaminase (Glucosamine-6-phosphate isomerase)
Functional Class:  G
The phylogenetic pattern of COG0363 is ----Y-vcEBrHuj--Olin-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000457 (Glucosamine/galactosamine-6-phosphate isomerase) with a combined E-value of 2.8e-67.
    IPB000457A    36-78
    IPB000457B    121-173
    IPB000457C    189-243


ProDom Summary:  Protein Domain Search
Residues 89-204 are 81% similar to a (ISOMERASE DEAMINASE) protein domain (PD006132) which is seen in Q9CMF4_PASMU.

Residues 1-88 are 77% similar to a (ISOMERASE DEAMINASE) protein domain (PD007348) which is seen in NAGB_HAEIN.

Residues 209-258 are 86% similar to a (DEAMINASE ISOMERASE) protein domain (PD012839) which is seen in Q9KKS5_VIBCH.



Paralogs:  Local Blast Search


HD1847 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 15 to 250 (E-value = 4.6e-180) place HD1847 in the Glucosamine_iso family which is described as Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase (PF01182)

PDB Hit:
pdb|1DEA|A Chain A, Mol_id: 1; Molecule: Glucosamine 6-Phosphat... 407 1e-114
pdb|1D9T|A Chain A, Human Glucosamine-6-Phosphate Deaminase Iso... 338 5e-094

Gene Protein Sequence:
MRLIPLKNDQQVAKWAASYIAQRINQFKPSAERPFVLGLPTGGTPLQTYQ
ELIKLYQAGEVSFKYVVTFNMDEYVGLAQDHPESYHSFMHNNFFKHIDIQ
AQNINILDGNTDDHQQECHRYEEKIKYYGKIHLFMGGVGIDGHIAFNEPA
SSLGSRTRIKTLTEDTLIANSRFFNNDISQVPKYALTIGVATLLDAEEIM
LLITGYNKALALQAGVEGSVNHLWTVSALQLHERSIIVCDEPATQELKVK
TVKYFTQLEAQEIASVC$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGTCTTATTCCCTTAAAAAATGATCAGCAAGTTGCAAAATGGGCAGC
GAGTTATATTGCTCAACGAATTAATCAATTTAAGCCAAGTGCAGAGCGTC
CTTTTGTATTAGGCTTACCAACGGGGGGAACACCCTTACAAACTTATCAA
GAGCTGATTAAGCTATATCAAGCGGGTGAAGTAAGTTTTAAATATGTCGT
GACCTTTAATATGGATGAATATGTTGGCTTAGCTCAAGATCATCCTGAAA
GTTATCATTCATTTATGCACAATAATTTTTTCAAGCATATCGATATTCAA
GCGCAGAATATTAATATTCTAGACGGCAATACGGATGATCATCAGCAAGA
ATGTCATCGTTATGAAGAAAAAATTAAATATTACGGCAAAATTCATTTAT
TTATGGGCGGTGTTGGGATTGATGGGCATATTGCCTTTAATGAACCGGCT
TCCTCATTGGGTTCTCGGACGCGGATTAAAACGTTGACAGAAGATACCCT
AATTGCCAACTCTCGTTTCTTTAATAACGATATCAGCCAAGTGCCTAAAT
ATGCGTTAACAATTGGGGTTGCAACGTTATTGGATGCAGAAGAAATAATG
TTATTGATCACCGGTTATAACAAAGCGTTGGCATTACAGGCTGGCGTAGA
AGGTTCCGTTAATCATTTATGGACAGTCAGTGCTTTACAATTACATGAAC
GCAGTATTATTGTTTGTGATGAACCCGCCACACAAGAATTAAAAGTAAAA
ACGGTGAAATATTTTACGCAATTAGAAGCACAAGAAATTGCAAGTGTATG
CTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy