Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1355 IGR1359 IGR1356 IGR1357 IGR1360 IGR1358 IGR1361 IGR1362 HD1852 nagB, - HD1847 nanA, - HD1850 wecA,rfe, - HD1844 wecB,rffE, - HD1843 rffA, - HD1840 nagA, - HD1845 wecC, - HD1842 menD, - HD1853 HD1852 nagB, - HD1847 nanA, - HD1850 wecA,rfe, - HD1844 wecB,rffE, - HD1843 rffA, - HD1840 nagA, - HD1845 wecC, - HD1842 menD, - HD1853 HD1852 nagB, - HD1847 nanA, - HD1850 wecA,rfe, - HD1844 wecB,rffE, - HD1843 nagA, - HD1845 wecC, - HD1842 nanA, - HD1849 rffC, - HD1841 nanA, - HD1849 rffA, - HD1840 rffC, - HD1841 menD, - HD1853
* Calculated from Protein Sequence

Gene ID: HD1845

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
nagA  

Definition:
N-acetylglucosamine-6-phosphate deacetylase

Gene Start:
1552993

Gene Stop:
1551848

Gene Length:
1146

Molecular Weight*:
40710

pI*:
6.40

Net Charge*:
-3.01

EC:
3.5.1.25  

Functional Class:
Central intermediary metabolism; Amino sugars  

Pathway: pathway table
Aminosugars metabolism

Secondary Evidence:
Yamano N, Oura N, Wang J, Fujishima S.
Cloning and sequencing of the genes for N-acetylglucosamine use that construct divergent operons (nagE-nagAC) from Vibrio
cholerae non-O1.
Biosci Biotechnol Biochem. 1997 Aug;61(8):1349-53.
PMID: 9301118


Plumbridge JA.
Repression and induction of the nag regulon of Escherichia coli K-12: the roles of nagC and nagA in maintenance of the uninduced
state.
Mol Microbiol. 1991 Aug;5(8):2053-62.
PMID: 1766379

Comment:


Blast Summary:  PSI-Blast Search
Several significant hits in gapped BLAST to N-acetylglucosamine-6-phosphate deacetylase proteins; e.g., residues 1-361 are 66% similar to NAGA_HAEIN, residues 1-361 are 54% similar to NAGA_VIBCH, and residues 4-359 are 54% similar to NAGA_ECOLI.

COGS Summary:  COGS Search
BeTs to 5 clades of COG1820
COG name: N-acetylglucosamine-6-phosphate deacetylase
Functional Class: G
The phylogenetic pattern of COG1820 is ------v-Ebrh----o----
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003764 (N-acetylglucosamine-6-phosphate deacetylase) with a combined E-value of 4.6e-34.
    IPB003764A    213-227
    IPB003764B    243-259
    IPB003764C    266-278
    IPB003764D    333-375


ProDom Summary:  Protein Domain Search
Residues 214-376 are 77% similar to a (DEACETYLASE) protein domain (PD001248) which is seen in Q9CMF5_PASMU.

Residues 52-213 are 71% similar to a (DEACETYLASE) protein domain (PD008493) which is seen in Q9CMF5_PASMU.

Residues 3-51 are 57% similar to a (DEACETYLASE CARBOHYDRATE) protein domain (PD346345) which is seen in NAGA_HAEIN.



Paralogs:  Local Blast Search

HD1845 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 51 to 363 (E-value = 4.7e-41) place HD1845 in the Amidohydro_1 family which is described as Amidohydrolase family (PF01979)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MKYALTNGVIYTAKDVLYGYAVVVENGIIQAVVRQTELASGLAKIDLQGN
NLTAGFIDLQLNGCGGVMFNEEPTVRTLEIMQQTNLRSGTTSFLPTFITA
PDEDMKHAVQTMRAYLATHQNQALGLHLEGPYLSLEKKGVHRAEYVRTLS
PPMKQFLLDNADVISKITLAAENPAAEAIPEFVQKGIVVSIGHSNATYPV
AKQAFAKGASFATHLHNAMSPISSGRAMGVVGAVLDSDDVYAGIIVDGLH
VEFGNIKIAKRAKGNKLCIVTDSTAAAGAEIEQFTFVGKTVYVRDGKCVD
ANGTLGGASITMIESIKNAVEQVGISLAESLRMCNYYPAQAIGVADKLGS
IEVGKIANLTAFNHRFEVVASSVNGEWYAFN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATATGCGTTAACGAATGGCGTTATTTATACGGCTAAAGACGTATT
GTATGGTTATGCGGTCGTTGTTGAAAATGGCATCATTCAAGCGGTCGTGC
GCCAAACCGAGTTGGCGAGTGGGCTAGCCAAGATTGATTTACAAGGAAAT
AATTTGACCGCTGGTTTTATTGATCTGCAATTAAATGGTTGTGGTGGCGT
TATGTTTAATGAAGAACCGACAGTTCGCACCTTAGAGATTATGCAACAAA
CCAATTTGCGTTCGGGTACAACCAGTTTTTTACCAACTTTTATTACAGCT
CCAGATGAGGATATGAAACACGCGGTGCAGACTATGCGCGCTTATTTAGC
AACACACCAAAATCAGGCATTAGGGTTGCATTTAGAAGGGCCATATCTCA
GCCTAGAGAAAAAAGGCGTGCATCGTGCGGAATATGTACGAACACTTTCG
CCACCGATGAAACAATTCTTATTGGATAATGCCGATGTTATTAGCAAAAT
TACCTTAGCGGCTGAAAATCCTGCCGCTGAAGCGATTCCTGAGTTTGTCC
AAAAAGGCATTGTTGTGTCAATAGGCCATTCAAATGCAACTTATCCGGTG
GCGAAACAAGCTTTTGCAAAGGGCGCAAGTTTTGCTACGCATTTACATAA
TGCTATGTCGCCAATTAGCAGTGGCCGAGCGATGGGTGTCGTAGGTGCTG
TGTTGGACAGCGATGATGTTTATGCGGGTATTATTGTGGATGGATTACAC
GTGGAGTTTGGCAATATCAAAATTGCTAAACGCGCCAAGGGTAATAAGTT
ATGTATTGTGACCGATTCAACCGCAGCAGCTGGGGCCGAGATTGAACAAT
TCACCTTTGTGGGTAAAACAGTCTATGTTCGTGATGGCAAATGTGTAGAT
GCGAATGGTACTTTGGGCGGGGCTTCAATTACGATGATTGAATCAATTAA
GAATGCGGTAGAACAAGTGGGCATTTCATTAGCAGAGAGTTTGCGTATGT
GTAATTATTATCCAGCACAAGCAATAGGTGTTGCGGATAAATTAGGTTCC
ATTGAGGTAGGTAAAATTGCTAATTTAACCGCTTTTAATCACCGTTTTGA
AGTGGTGGCTAGTAGCGTAAATGGTGAATGGTATGCTTTTAATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy