Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1355 IGR1359 IGR1356 IGR1357 IGR1360 IGR1358 IGR1361 IGR1362 HD1852 nagB, - HD1847 nanA, - HD1850 wzxE, - HD1838 wecA,rfe, - HD1844 wecB,rffE, - HD1843 rffA, - HD1840 nagA, - HD1845 wecC, - HD1842 menD, - HD1853 HD1852 nagB, - HD1847 nanA, - HD1850 wzxE, - HD1838 wecA,rfe, - HD1844 wecB,rffE, - HD1843 rffA, - HD1840 nagA, - HD1845 wecC, - HD1842 menD, - HD1853 HD1852 nagB, - HD1847 nanA, - HD1850 wzxE, - HD1838 wecA,rfe, - HD1844 wecB,rffE, - HD1843 rffA, - HD1840 nagA, - HD1845 wecC, - HD1842 nanA, - HD1849 rffC, - HD1841 nanA, - HD1849 rffC, - HD1841 menD, - HD1853
* Calculated from Protein Sequence

Gene ID: HD1844

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
wecA  rfe  

Definition:
undecaprenyl-phosphate alpha-N-acetylglucosaminyltransferase

Gene Start:
1551654

Gene Stop:
1550590

Gene Length:
1065

Molecular Weight*:
39742

pI*:
10.80

Net Charge*:
15.82

EC:
2.4.1.-  

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table

Secondary Evidence:
Amer AO, Valvano MA.
Conserved aspartic acids are essential for the enzymic activity of the WecA protein initiating the biosynthesis of O-specific
lipopolysaccharide and enterobacterial common antigen in Escherichia coli.
Microbiology. 2002 Feb;148(Pt 2):571-82.
PMID: 11832520

Amer AO, Valvano MA.
Conserved amino acid residues found in a predicted cytosolic domain of the lipopolysaccharide biosynthetic protein WecA are
implicated in the recognition of UDP-N-acetylglucosamine.
Microbiology. 2001 Nov;147(Pt 11):3015-25.
PMID: 11700352

Phillips NJ, Miller TJ, Engstrom JJ, Melaugh W, McLaughlin R, Apicella MA, Gibson BW.
Characterization of chimeric lipopolysaccharides from Escherichia coli strain JM109 transformed with lipooligosaccharide synthesis
genes (lsg) from Haemophilus influenzae.
J Biol Chem. 2000 Feb 18;275(7):4747-58.
PMID: 10671507

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to putative undecaprenyl-phosphate alpha-N-acetylglucosaminyltransferase (rfe) proteins, which are involved in the synthesis of enterobacterial common antigens; e.g., residues 34-366 are 63% similar to RFE_HAEIN and residues 37-366 are 53% similar to RFE_ECOLI.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0472
COG name: UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N- acetylglucosamine-1-phosphate transferase
Functional Class: M
The phylogenetic pattern of COG0472 is -mTkyQVCEBRHUJ--olinX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB003524 (Phospho-N-acetylmuramoyl-pentapeptide-transferase) with a combined E-value of 3.4e-06.
    IPB003524D    139-156
    IPB003524E    189-222


ProDom Summary:  Protein Domain Search
Residues 86-289 are 29% similar to a (TRANSFERASE TRANSMEMBRANE) protein domain (PD001416) which is seen in Q53761_STAAU.

Residues 136-229 are 67% similar to a (TRANSFERASE) protein domain (PD006173) which is seen in RFE_HAEIN.

Residues 244-311 are 60% similar to a (TRANSFERASE UNDECAPRENYL-PHOSPHATE) protein domain (PD413352) which is seen in RFE_ECOLI.

Residues 3-85 are 62% similar to a (TRANSFERASE PROTEOME COMPLETE) protein domain (PD259181) which is seen in Q9CNG8_PASMU.

Residues 244-335 are 67% similar to a (TRANSFERASE UNDECAPRENYL-PHOSPHATE) protein domain (PD020800) which is seen in RFE_HAEIN.



Paralogs:  Local Blast Search
HD1844 is paralogously related to HD0244 (1e-08).


Pfam Summary:  Pfam Search
Residues 68 to 247 (E-value = 5.9e-10) place HD1844 in the Glycos_transf_4 family which is described as Glycosyl transferase (PF00953)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MWLTFIAVFIVSFASLILMRPVAEKIGLIDKPNYRKRHQGLIPLIGGIAL
FLGNLTFYFIEWQDMRLPWLYLTAVTVLLVIGLLDDRFDVSPFLRIGLQA
GLAGLMIYHGLSLESLGQVIAPFSIKLGILGTVFTILITIGVINAFNMVD
GIDGLLAGLSSASFAGIGVLMWLDEQYSLAYWCFALIVVLIPYAMFNLSL
LGAKWKVFMGDSGSTLIGFTIIWILLLSTQGQGHAISPITGLWLIAVPLI
DMVAVVLRRLKKGKSPFRPDRLHLHHLMMRAGLTSRQALAVITLGATICS
MIGVFGEYYYWNQWAMTAGFIALFFIYAYSITHAWRMTRFIRRMKRREKR
KQHA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTGGCTTACTTTTATCGCAGTTTTTATTGTTTCATTTGCTAGCTTAAT
TTTGATGCGCCCAGTGGCAGAGAAAATAGGCTTAATAGATAAACCAAACT
ATCGTAAACGTCATCAAGGTTTAATTCCTCTTATCGGTGGGATTGCGCTT
TTTTTAGGTAATTTAACGTTCTATTTTATTGAATGGCAAGATATGCGTTT
GCCTTGGTTATACCTAACAGCGGTTACGGTGTTGTTAGTGATCGGCTTAT
TAGATGATCGCTTTGATGTCAGCCCATTTTTACGGATAGGCTTACAAGCA
GGGCTAGCAGGATTAATGATTTACCACGGACTATCCTTAGAAAGTTTAGG
GCAAGTGATTGCTCCATTTAGTATTAAATTAGGCATTTTAGGCACAGTAT
TTACGATTTTGATTACAATTGGCGTGATTAATGCATTTAATATGGTCGAT
GGTATTGATGGTTTATTAGCCGGATTATCTAGCGCTAGTTTTGCCGGTAT
TGGCGTGTTGATGTGGTTAGATGAGCAATATAGCTTAGCTTATTGGTGCT
TCGCACTAATTGTCGTATTAATTCCTTATGCCATGTTTAATCTCAGTTTA
TTGGGTGCTAAATGGAAAGTGTTTATGGGTGATTCCGGCAGTACCTTAAT
TGGTTTTACGATTATTTGGATTTTATTGCTCAGTACACAAGGACAGGGGC
ATGCGATTAGCCCGATCACCGGTTTATGGCTAATAGCCGTGCCATTGATT
GATATGGTAGCAGTGGTTCTTCGCCGTTTGAAAAAAGGCAAAAGTCCATT
TAGACCAGACCGCTTGCATTTACATCATTTAATGATGCGGGCAGGGTTAA
CCTCACGACAAGCATTGGCAGTGATTACGTTAGGTGCAACCATTTGCTCA
ATGATTGGGGTTTTTGGTGAATATTATTATTGGAATCAATGGGCCATGAC
GGCGGGTTTTATCGCCTTATTTTTTATTTATGCTTATTCTATTACGCACG
CGTGGCGTATGACGCGTTTTATTCGTCGTATGAAACGTAGAGAAAAAAGA
AAACAGCACGCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy