Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1355 IGR1354 IGR1359 IGR1356 IGR1357 IGR1360 IGR1358 IGR1361 nagB, - HD1847 nanA, - HD1850 wzxE, - HD1838 wecA,rfe, - HD1844 wecB,rffE, - HD1843 wecF, - HD1836 rffA, - HD1840 nagA, - HD1845 wecC, - HD1842 nagB, - HD1847 nanA, - HD1850 wzxE, - HD1838 wecA,rfe, - HD1844 wecB,rffE, - HD1843 wecF, - HD1836 rffA, - HD1840 nagA, - HD1845 wecC, - HD1842 nagB, - HD1847 nanA, - HD1850 wzxE, - HD1838 wecA,rfe, - HD1844 wecB,rffE, - HD1843 rffA, - HD1840 nagA, - HD1845 wecC, - HD1842 nanA, - HD1849 wzxE, - HD1837 rffC, - HD1841 nanA, - HD1849 rffC, - HD1841 wecF, - HD1836 wzxE, - HD1837
* Calculated from Protein Sequence

Gene ID: HD1843

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
wecB  rffE  

Definition:
UDP-N-acetylglucosamine 2-epimerase

Gene Start:
1550509

Gene Stop:
1549430

Gene Length:
1080

Molecular Weight*:
40177

pI*:
5.10

Net Charge*:
-11.57

EC:
5.1.3.14  

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table
Aminosugars metabolism

Secondary Evidence:
Marolda,C.L. and Valvano,M.A.
Genetic analysis of the dTDP-rhamnose biosynthesis region of the
Escherichia coli VW187 (O7:K1) rfb gene cluster: identification of
functional homologs of rfbB and rfbA in the rff cluster and correct location of the rffE gene
J. Bacteriol. 177 (19), 5539-5546 (1995)

Macpherson,D.F., Manning,P.A. and Morona,R.
Characterization of the dTDP-rhamnose biosynthetic genes encoded in the rfb locus of Shigella flexneri
Mol. Microbiol. 11 (2), 281-292 (1994)
MEDLINE: 94224146

Campbell,R.E., Mosimann,S.C., Tanner,M.E. and Strynadka,N.C.
The structure of UDP-N-acetylglucosamine 2-epimerase reveals
homology to phosphoglycosyl transferases
Biochemistry 39 (49), 14993-15001 (2000)
MEDLINE: 20560576


Comment:
0

Blast Summary:  PSI-Blast Search
Residues 1-359 are 60% similar to >22124279 UDP-N-acetyl glucosamine -2-epimerase [Yersinia pestis KIM].

Numerous significant hits in gapped BLAST to UDP-N-acetylglucosamine 2-epimerase (UDP-GlcNAc-2-epimerase), also known as bacteriophase N4 adsorption protein C. Residues 1-359 are 59% similar to WECB_ECOLI. Residues 1-359 are 60% similar to a the Salmonella typhimurium LT2 sequence that is 86% similar to E. coli UDP-N-acetyl-D-glucosamine 2-epimerase. Residues 1-359 are 60% similar to a putative UDP-N-acetylglucosamine 2-epimerase in Acinetobacter lwoffii.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0381
COG name: UDP-N-acetylglucosamine 2-epimerase
Functional Class:  M
The phylogenetic pattern of COG0381 is -mtk--Vceb----------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003331 (UDP-N-acetylglucosamine 2-epimerase) with a combined E-value of 4.2e-102.
    IPB003331B    39-76
    IPB003331C    81-117
    IPB003331D    144-162
    IPB003331E    189-204
    IPB003331F    223-238
    IPB003331G    268-311
    IPB003331H    339-352


ProDom Summary:  Protein Domain Search
Residues 39-354 are 59% similar to a (2-EPIMERASE UDP-N-ACETYLGLUCOSAMINE) protein domain (PD004092) which is seen in Q9RMD6_ACILW.



Paralogs:  Local Blast Search

HD1843 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 6 to 355 (E-value = 4.7e-163) place HD1843 in the Epimerase_2 family which is described as UDP-N-acetylglucosamine 2-epimerase (PF02350)

PDB Hit:
pdb|1F6D|A Chain A, The Structure Of Udp-N-Acetylglucosamine 2-... 433 2e-122

Gene Protein Sequence:
MAPLITKLVTEEAFEAKLCVTGQHREMLDQVLTLFDLKPDFDLAIMQAGQ
DLTDISVRILQQLKILFAEYRPDIVLVHGDTTTALASSLACYYHQIPLAH
IEAGLRTGNRFSPFPEEINRQLISSLADYHFAPTETAKQNLLRENKPAQQ
IWVTGNTVIDALRLALAKIEANQHLQHQLAEQYAFLDPNKPLILVTCHRR
ESFGKGIQNICVALLELANRYPDIQIVYPLHLNPNVRQPVQDLLANIDNI
FLIEPQDYLPFVYLMDRSYLILTDSGGIQEEAPALAKPVLVMRDISERSE
AIAVGAVRIVGTDSDNIVAEVHQLLTDKSAYQQMAQAGNPYGQGDACQQI
IAILKQHLI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCACCTTTAATAACCAAATTGGTTACAGAAGAGGCGTTTGAGGCTAA
ATTGTGTGTCACCGGTCAACATCGTGAAATGTTGGATCAGGTGTTAACCT
TATTTGATTTAAAGCCTGATTTTGATTTAGCTATTATGCAGGCGGGGCAA
GATTTAACGGATATTAGTGTGCGTATTTTGCAACAATTAAAAATACTCTT
TGCAGAGTATCGACCAGATATTGTTTTAGTACACGGCGATACGACCACTG
CTTTAGCCAGTAGCTTAGCCTGTTATTATCATCAAATTCCATTGGCACAT
ATTGAAGCAGGATTACGGACAGGCAACCGTTTTTCGCCTTTTCCTGAAGA
AATAAATCGCCAGTTAATCAGCAGCTTAGCGGACTATCATTTTGCACCGA
CTGAGACAGCCAAACAAAATTTATTACGTGAAAATAAACCCGCGCAGCAG
ATTTGGGTAACGGGTAACACTGTTATTGATGCATTGAGGTTAGCCTTGGC
AAAAATTGAAGCGAATCAGCATTTACAACATCAGTTAGCTGAGCAATATG
CTTTTTTAGATCCCAATAAACCATTGATTTTAGTCACTTGTCATCGGCGA
GAAAGCTTTGGAAAAGGGATTCAGAATATTTGTGTTGCATTACTTGAATT
AGCGAATCGTTATCCAGATATTCAAATTGTTTACCCGCTTCACTTAAATC
CCAACGTTCGCCAACCCGTGCAAGATTTGTTGGCAAATATTGATAATATT
TTTTTAATTGAGCCTCAAGATTATCTGCCATTTGTTTATTTAATGGATCG
TTCTTATTTGATTTTGACAGACTCTGGTGGCATTCAAGAAGAGGCTCCTG
CCTTAGCTAAGCCAGTGTTGGTGATGAGAGATATTTCAGAGCGTAGCGAG
GCGATTGCGGTAGGTGCCGTGCGGATAGTGGGAACCGATAGCGACAATAT
TGTGGCTGAGGTGCATCAGTTATTAACAGATAAGTCGGCTTATCAACAGA
TGGCTCAAGCCGGTAATCCTTATGGGCAAGGGGATGCTTGTCAGCAGATT
ATTGCGATCCTGAAACAACATTTAATCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy