Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1355 IGR1354 IGR1359 IGR1356 IGR1357 IGR1358 nagB, - HD1847 wzxE, - HD1838 wecA,rfe, - HD1844 wecB,rffE, - HD1843 rffA, - HD1840 nagA, - HD1845 wecC, - HD1842 wecF, - HD1835 nagB, - HD1847 wzxE, - HD1838 wecA,rfe, - HD1844 wecB,rffE, - HD1843 rffA, - HD1840 nagA, - HD1845 wecC, - HD1842 wecF, - HD1835 nagB, - HD1847 wzxE, - HD1838 wecA,rfe, - HD1844 wecB,rffE, - HD1843 rffA, - HD1840 nagA, - HD1845 wecC, - HD1842 wzxE, - HD1837 rffC, - HD1841 wecF, - HD1836 wzxE, - HD1837 rffC, - HD1841 wecF, - HD1836 wecF, - HD1835
* Calculated from Protein Sequence

Gene ID: HD1842

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
wecC  

Definition:
UDP-N-acetyl-D-mannosaminuronic acid dehydrogenase

Gene Start:
1549367

Gene Stop:
1548090

Gene Length:
1278

Molecular Weight*:
46196

pI*:
5.70

Net Charge*:
-6.54

EC:
1.1.1.-  

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table
Ascorbate and aldarate metabolism
Bile acid biosynthesis
Butanoate metabolism
Fructose and mannose metabolism
Galactose metabolism
Glycine, serine and threonine metabolism
Lysine degradation
Nucleotide sugars metabolism
Phenylalanine metabolism
Vitamin B6 metabolism

Comment:


Blast Summary:  PSI-Blast Search
Residues 3-419 are 61% similar to gi16762209 UDP-ManNAc dehydrogenase [Salmonella enterica subsp. enterica serovar Typhi].

Numerous significant hits with gapped BLAST to UDP-N-acetyl-D-mannosaminuronic acid (UDP-ManNAcA) dehydrogenase; e.g., residues 7-423 are 61% similar to WECC_ECOLI; residues 6-405 are also 60% similar to a protein produced by Salmonella typhimurium that is 90% similar to the E. coli UDP-N-acetyl-D-mannosaminuronic acid dehydrogenase. Residues 5-421 are 60 % similar to UDP-N-acetylglucosamine-2-epimerase in Pasteurella haemolytica. Residues 7-378 are 64% similar to Genbank ref. AAA67587.1 (M87049), E. coli UDP-ManNAc dehydrogenase, possible rffD

COGS Summary:  COGS Search
BeTs to 4 clades of COG0677
COG name: UDP-N-acetyl-D-mannosaminuronate dehydrogenase
Functional Class: M
The phylogenetic pattern of COG0677 is -mtK----e------------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001732 (UDP-glucose/GDP-mannose dehydrogenase family) with a combined E-value of 2.1e-96.
    IPB001732A    6-18
    IPB001732B    30-57
    IPB001732C    77-87
    IPB001732D    115-125
    IPB001732E    155-180
    IPB001732F    201-255
    IPB001732G    262-271
    IPB001732H    322-362


ProDom Summary:  Protein Domain Search
Residues 324-419 are 53% similar to a (DEHYDROGENASE UDP-GLUCOSE COMPLETE PROTEOME) protein domain (PD001281) which is seen in Q9KTI4_VIBCH.

Residues 175-267 are 78% similar to a (DEHYDROGENASE UDP-GLUCOSE OXIDOREDUCTASE NAD) protein domain (PD001282) which is seen in Q9RP71_PASHA.

Residues 7-130 are 64% similar to a (DEHYDROGENASE OXIDOREDUCTASE UDP-GLUCOSE NAD COMPLETE) protein domain (PD001278) which is seen in Q9L9K7_PASMU.

Residues 152-239 are 73% similar to a (DEHYDROGENASE COMPLETE PROTEOME ACID) protein domain (PD190504) which is seen in Q9RMD5_ACILW.

Residues 106-144 are 64% similar to a (DEHYDROGENASE ACID) protein domain (PD244376) which is seen in Q9RMD5_ACILW.

Residues 6-130 are 40% similar to a (DEHYDROGENASE) protein domain (PD398280) which is seen in Q9FBM9_STRCO.

Residues 268-305 are 81% similar to a (DEHYDROGENASE ACID) protein domain (PD393926) which is seen in Q9L6R4_BBBBB.

Residues 243-302 are 42% similar to a (COMPLETE PROTEOME DEHYDROGENASE) protein domain (PD229939) which is seen in Q9UZI2_PYRAB.



Paralogs:  Local Blast Search
HD1842 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 5 to 198 (E-value = 2.4e-80) place HD1842 in the UDPG_MGDP_dh_N family which is described as UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain (PF03721)
Residues 206 to 298 (E-value = 4.6e-44) place HD1842 in the UDPG_MGDP_dh family which is described as UDP-glucose/GDP-mannose dehydrogenase family, central domain (PF00984)
Residues 325 to 416 (E-value = 2.2e-17) place HD1842 in the UDPG_MGDP_dh_C family which is described as UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain (PF03720)

PDB Hit:
pdb1DLIA Chain A, The First Structure Of Udp-Glucose Dehydrog... 71 2e-013
pdb1DLJA Chain A, The First Structure Of Udp-Glucose Dehydrog... 68 3e-012

Gene Protein Sequence:
MNSFQTISVVGLGYIGLPTAAVFAQAGKRVLGVDINQQTVTTINQGNIHI
VEPALAEVVQQAIEKGVLSASTAVQPADVFIIAVPTPFDQDHQPDLSYIK
AAAEMIAPHLQAGNLVVLESTSPVGTTEQLAEWLQQARPDLLLPTSTTAK
PNIQLAYCPERVLPGKVMTELLTNDRVIGGITAEATQQAVDLYKIFVKGR
CIPTNARTAEMCKLTENSFRDVNIAFANELSMVCDQLNINVWQLIALANC
HPRVNILQPSAGVGGHCIAVDPWFIVAQAPQQARLIQTARQVNDAKPHWV
IKQIKQMWADCIMANNCRPSDIKIACLGLAFKPDIDDLRASPALEITQHL
TEWQLAELMVVEPNITDLPTSLVGKAQLVSLEYAMTQADILVLLVAHTPF
KAVASQLLSAKWRLDICGLQAVTRT$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATAGTTTTCAAACCATTTCGGTGGTGGGGTTAGGGTATATCGGGTT
ACCTACAGCAGCGGTTTTTGCACAAGCGGGCAAACGAGTTTTAGGTGTGG
ATATTAATCAGCAAACAGTAACAACGATTAATCAAGGTAATATTCATATT
GTTGAGCCGGCATTAGCGGAAGTTGTGCAACAAGCGATTGAAAAAGGGGT
ATTGTCGGCGAGTACAGCAGTACAACCTGCTGATGTATTTATAATTGCAG
TACCCACGCCTTTTGATCAGGATCATCAGCCAGATTTGAGCTACATTAAA
GCTGCGGCGGAAATGATCGCACCTCACTTACAAGCGGGTAATTTAGTTGT
ATTAGAATCCACTTCGCCAGTTGGGACTACCGAACAATTAGCCGAATGGT
TACAACAAGCGCGTCCCGATCTGCTTTTACCGACTTCAACAACAGCCAAG
CCTAATATTCAATTGGCTTATTGTCCTGAACGGGTACTGCCCGGTAAAGT
CATGACAGAATTATTGACTAATGATCGTGTGATTGGTGGAATAACCGCAG
AAGCTACGCAACAAGCGGTAGATTTATACAAAATTTTTGTTAAAGGGCGC
TGTATTCCAACTAATGCACGTACTGCAGAAATGTGTAAATTAACAGAAAA
TAGTTTTCGGGACGTGAATATTGCATTTGCTAATGAATTATCTATGGTTT
GCGATCAGCTTAACATTAATGTTTGGCAATTAATTGCATTAGCTAACTGT
CACCCACGCGTTAATATTTTACAACCCAGTGCGGGTGTCGGTGGCCATTG
TATCGCAGTCGACCCTTGGTTTATTGTTGCTCAAGCCCCTCAGCAAGCAC
GTTTAATTCAGACCGCTCGGCAGGTTAATGATGCTAAACCGCATTGGGTA
ATTAAGCAGATTAAACAGATGTGGGCAGACTGTATAATGGCTAATAATTG
TCGGCCAAGTGATATCAAAATAGCTTGCCTAGGGCTAGCATTTAAGCCAG
ATATTGATGATTTACGTGCTAGCCCTGCCCTTGAAATTACGCAACATTTA
ACTGAATGGCAATTAGCTGAACTTATGGTGGTTGAGCCGAATATCACTGA
TTTACCGACATCGTTAGTGGGGAAAGCACAGTTAGTGAGCTTAGAATATG
CAATGACACAAGCGGATATTTTAGTCTTGTTAGTGGCACATACACCGTTT
AAAGCGGTTGCTTCACAGCTGTTGTCAGCTAAATGGCGGTTAGATATTTG
TGGTTTGCAGGCAGTAACGAGAACATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy