Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1355 IGR1354 IGR1356 IGR1357 IGR1358 wzxE, - HD1838 wecA,rfe, - HD1844 wecB,rffE, - HD1843 rffA, - HD1840 nagA, - HD1845 wecC, - HD1842 wecF, - HD1835 wzxE, - HD1838 wecA,rfe, - HD1844 wecB,rffE, - HD1843 rffA, - HD1840 nagA, - HD1845 wecC, - HD1842 wecF, - HD1835 wzxE, - HD1838 wecA,rfe, - HD1844 wecB,rffE, - HD1843 rffA, - HD1840 nagA, - HD1845 wecC, - HD1842 wecF, - HD1835 wzxE, - HD1837 rffC, - HD1841 wecF, - HD1836 wzxE, - HD1837 rffC, - HD1841 wecF, - HD1836
* Calculated from Protein Sequence

Gene ID: HD1841

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
rffC  

Definition:
lipopolysaccharide biosynthesis protein

Gene Start:
1548087

Gene Stop:
1547413

Gene Length:
675

Molecular Weight*:
25424

pI*:
7.70

Net Charge*:
1.67

EC:
 

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table

Secondary Evidence:
Barr K, Rick PD.
Physical map location of the rffC and rffA genes of Escherichia coli.
J Bacteriol. 1993 Sep;175(17):5738-9. No abstract available.
PMID: 8366065

Meier-Dieter U, Barr K, Starman R, Hatch L, Rick PD.
Nucleotide sequence of the Escherichia coli rfe gene involved in the synthesis of enterobacterial common antigen. Molecular cloning
of the rfe-rff gene cluster.
J Biol Chem. 1992 Jan 15;267(2):746-53.
PMID: 1730666

Comment:
0

Blast Summary:  PSI-Blast Search
A few moderate hits in gapped BLAST to lipopolysaccharide biosynthesis proteins; e.g., residues 41-232 are 33% similar to RFFC_ECOLI [140873]. Residues 41-232 are also 34% similar to a protein in Salmonella typhimurium LT2 [6960273] that shares 62-84% identity (with one gap) with E. coli lipopolysaccharide biosynthesis protein WECD.

COGS Summary:  COGS Search
BeTs to 3 clades of COG0454
COG name: Predicted acetyltransferases
Functional Class:  R
The phylogenetic pattern of COG0454 is AmTKYqVCEBR-uj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 25-216 are 33% similar to a (BIOSYNTHESIS LIPOPOLYSACCHARIDE FAMILY) protein domain (PD102348) which is seen in RFFC_ECOLI.



Paralogs:  Local Blast Search


HD1841 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 124 to 207 (E-value = 3.9e-14) place HD1841 in the Acetyltransf_1 family which is described as Acetyltransferase (GNAT) family (PF00583)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MLNSTSSTIISPDQWLSDFFGRPIVQVKVATADHQQIQKLAQQGLQLASS
EIVFALPLTNKVCKPTTCQQATTCDLNELTWLFGQAFPRSRFGPPWFSAS
ENCRFYQTWIRRAVQGEFDDLCLIQRSEDGQLQGGISLRRQQQEGQPPYA
QVGLLAVDPLFQRQGVGRTLLQASINWALTQQLEHLVISTQLSNLNAINC
YLTFNARVVSTHYWFYPRLHNDSF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTGAATTCAACATCATCAACCATTATTTCGCCAGATCAATGGCTATC
AGATTTTTTTGGTCGTCCTATTGTGCAAGTAAAAGTGGCTACTGCCGATC
ATCAACAAATACAAAAGCTAGCGCAACAAGGTTTGCAATTAGCCAGCAGT
GAGATCGTCTTTGCATTGCCATTAACAAATAAAGTGTGCAAACCAACCAC
TTGTCAGCAAGCAACAACTTGCGATCTTAATGAATTAACATGGTTATTTG
GTCAAGCATTTCCGCGTAGCCGTTTTGGTCCGCCTTGGTTTTCAGCTTCT
GAAAATTGCCGCTTCTATCAAACGTGGATTCGGCGAGCGGTACAAGGTGA
ATTTGATGATCTTTGCTTAATTCAACGATCAGAAGATGGGCAATTACAAG
GCGGGATTAGCCTCAGAAGGCAACAACAAGAGGGACAACCGCCTTATGCC
CAAGTAGGGTTATTGGCAGTTGATCCGCTTTTTCAACGCCAAGGGGTTGG
GCGAACATTATTACAAGCGTCTATAAATTGGGCATTAACACAACAGCTTG
AACATTTAGTGATTAGTACACAATTGAGCAATTTAAATGCAATAAATTGT
TATTTAACTTTCAATGCTCGAGTCGTAAGCACTCATTATTGGTTTTACCC
ACGGTTACACAATGATTCCTTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy