Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-His-1 tRNA-Pro-2 tRNA-Arg-3 rRNA-16S-5 IGR1353 IGR1355 IGR1354 IGR1356 IGR1357 IGR1352 HD1833 wzxE, - HD1838 wecA,rfe, - HD1844 wecB,rffE, - HD1843 rffA, - HD1840 wecC, - HD1842 wecF, - HD1835 HD1833 wzxE, - HD1838 wecA,rfe, - HD1844 wecB,rffE, - HD1843 rffA, - HD1840 wecC, - HD1842 wecF, - HD1835 HD1833 wzxE, - HD1838 wecA,rfe, - HD1844 wecB,rffE, - HD1843 rffA, - HD1840 wecC, - HD1842 wecF, - HD1835 wzxE, - HD1837 rffC, - HD1841 wecF, - HD1836 wzxE, - HD1837 rffC, - HD1841 wecF, - HD1836
* Calculated from Protein Sequence

Gene ID: HD1838

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
wzxE  

Definition:
lipopolysaccharide biosynthesis protein, WZXE-like

Gene Start:
1546296

Gene Stop:
1545466

Gene Length:
831

Molecular Weight*:
30026

pI*:
10.10

Net Charge*:
10.42

EC:
 

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
A few significant hits in gapped BLAST to lipopolysaccharide biosynthesis proteins; e.g., residues 4-275 are 42% similar to WZXE_ECOLI (140875); to o416, a 45-kD hypothetical protein in the rffE-rffT intergenic region of E. Coli K-12 (7466008), possible rffA or rffC (148195); and to a putative cytochrome in E. coli (1790227). In addition, residues 4-275 are 39% similar to a gene in Salmonella typhimurium LT2 that is similar to the E. coli lipopolysaccharide biosynthesis protein WZXE.

COGS Summary:  COGS Search
BeTs to 4 clades of COG2244
COG name: Membrane protein involved in the export of O-antigen and teichoic acid, RfbX family
Functional Class: R
The phylogenetic pattern of COG2244 is aMTK-Qv-EB-----------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 4-111 are 40% similar to a (COMPLETE PROTEOME TRANSMEMBRANE VIRULENCE) protein domain (PD005504) which is seen in WZXE_ECOLI.

Residues 116-275 are 43% similar to a (BIOSYNTHESIS LIPOPOLYSACCHARIDE ZXE) protein domain (PD140051) which is seen in WZXE_ECOLI.



Paralogs:  Local Blast Search

HD1838 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MQLLSKIAIWTTLATLFKLVVGLLVLKLLGWQFGTAGLGQAANFMTLITV
LTVFAGGGIANGVTKYVAEFEHHLPKQQALLATANLITVFFSCLLAVCFI
SFSHKISEWLFYTSTYSGVIIATGIMQFGIACSHYALAILKGYRAVKAVA
ISLILGTLIGLVVCLIAFYIAGYQGILIGLVAIPAFTFLPASYFLHKQLS
IVKLRCFAFVPQQASNLFKFSLMVLITAVTLPVAHILMRQLIVESHSFTD
VGLWQAVSKISDAYIQLITVVFSVFT$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAGTTGTTAAGTAAAATAGCGATTTGGACTACATTAGCGACCTTATT
CAAATTAGTGGTTGGCTTGCTCGTGCTGAAACTTTTGGGGTGGCAGTTTG
GTACAGCAGGCTTAGGACAAGCAGCCAATTTTATGACGTTGATCACAGTC
TTGACGGTCTTTGCTGGTGGCGGTATCGCGAATGGTGTAACTAAATATGT
AGCAGAGTTTGAACATCATTTACCAAAACAGCAGGCTTTGTTGGCAACGG
CTAATTTGATTACGGTATTCTTTTCTTGCCTATTAGCGGTCTGTTTTATT
AGTTTTTCTCACAAAATCAGTGAATGGTTGTTTTATACCTCGACATATAG
TGGCGTCATCATTGCCACAGGCATAATGCAATTTGGTATTGCCTGTAGTC
ATTATGCGTTGGCGATTTTAAAAGGTTATCGTGCGGTTAAAGCGGTAGCA
ATTAGCCTGATATTGGGAACCTTAATCGGCTTGGTGGTTTGCTTAATCGC
ATTCTATATCGCGGGCTATCAAGGCATCTTAATTGGGTTAGTTGCCATTC
CGGCCTTTACTTTTTTACCGGCTAGCTATTTTCTGCATAAACAGTTGTCA
ATAGTCAAGTTACGTTGTTTTGCCTTTGTGCCACAACAGGCTAGTAACTT
ATTCAAATTTAGTTTGATGGTATTGATCACGGCAGTGACTTTACCTGTAG
CACATATTTTAATGCGACAGTTAATCGTTGAATCACACTCATTCACGGAT
GTTGGTTTATGGCAAGCCGTTAGCAAAATATCAGATGCTTATATACAATT
AATCACGGTTGTTTTTTCGGTTTTTACCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy