Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-His-1 tRNA-Pro-2 tRNA-Arg-3 rRNA-16S-5 IGR1353 IGR1355 IGR1354 IGR1356 IGR1352 HD1833 wzxE, - HD1838 wecB,rffE, - HD1843 rffA, - HD1840 wecC, - HD1842 wecF, - HD1835 HD1833 wzxE, - HD1838 wecB,rffE, - HD1843 rffA, - HD1840 wecC, - HD1842 wecF, - HD1835 HD1833 wzxE, - HD1838 wecB,rffE, - HD1843 rffA, - HD1840 wecC, - HD1842 wecF, - HD1835 wzxE, - HD1837 rffC, - HD1841 wecF, - HD1836 wzxE, - HD1837 rffC, - HD1841 wecF, - HD1836
* Calculated from Protein Sequence

Gene ID: HD1837

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
wzxE  

Definition:
lipopolysaccharide biosynthesis protein, WZXE-like

Gene Start:
1545488

Gene Stop:
1545036

Gene Length:
453

Molecular Weight*:
17161

pI*:
10.30

Net Charge*:
8.32

EC:
 

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 6-147 are 40% similar to >16123993 putative lipopolysaccharide biosynthesis protein [Yersinia pestis].

Also, several moderate hits in gapped BLAST to lipopolysaccharide biosynthesis proteins; e.g., residues 6-145 are 39% similar to a protein in Salmonella typhimurium LT2 that is, in turn, 89% similar to the E. coli lipopolysaccharide biosynthesis protein WZXE; residues 6-145 are 39% similar to WZXE_ECOLI and to a hypothetical 45 kD protein found in the rffE-rffT intergenic region in E. coli K-12.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 6-145 are 39% similar to a (BIOSYNTHESIS LIPOPOLYSACCHARIDE ZXE) protein domain (PD140051) which is seen in Q9L6Q9_BBBBB.



Paralogs:  Local Blast Search

HD1837 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LFFRFLPSLAKLHSAEAIKTELQRVIKWVAMVLSFIALLIFISREWLIML
LYSPAFLSMKVLFGWQLLGDIFKVLAYVFGYLVIAKARLTLYLLAELIQL
GLLVGIGYLLIPQYGTVGAVQTYCLTYLCYLIVCIAVFMLYLKRSSPKQH
$

Gene Nucleotide Sequence:  Sequence Viewer
TTGTTTTTTCGGTTTTTACCTAGTTTGGCTAAATTACACTCTGCTGAAGC
GATTAAAACAGAATTACAGCGCGTGATTAAATGGGTCGCAATGGTATTAT
CATTCATCGCCTTGTTGATATTTATTAGCCGTGAATGGTTAATTATGCTA
CTTTATTCGCCCGCTTTTTTATCAATGAAAGTGCTGTTTGGTTGGCAATT
GTTGGGTGATATTTTTAAAGTGCTTGCCTATGTTTTTGGTTATTTGGTGA
TTGCGAAAGCGCGTTTAACATTATATTTATTGGCAGAGTTAATACAACTT
GGTTTATTAGTCGGCATTGGCTATTTACTGATCCCTCAATATGGCACAGT
TGGCGCAGTGCAAACATATTGTTTGACGTATTTATGCTATTTGATCGTCT
GTATTGCAGTATTTATGCTTTACTTGAAACGATCTTCGCCTAAACAGCAC
TGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy