Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-His-1 tRNA-Glu-2 tRNA-Pro-2 tRNA-Arg-3 rRNA-16S-5 IGR1353 IGR1355 IGR1354 IGR1356 IGR1352 HD1833 wzxE, - HD1838 wecB,rffE, - HD1843 rffA, - HD1840 wecC, - HD1842 wecF, - HD1835 HD1833 wzxE, - HD1838 wecB,rffE, - HD1843 rffA, - HD1840 wecC, - HD1842 wecF, - HD1835 HD1833 wzxE, - HD1838 wecB,rffE, - HD1843 rffA, - HD1840 wecC, - HD1842 wecF, - HD1835 wzxE, - HD1837 rffC, - HD1841 wecF, - HD1836 wzxE, - HD1837 rffC, - HD1841 wecF, - HD1836
* Calculated from Protein Sequence

Gene ID: HD1836

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
wecF  

Definition:
4-alpha-l-fucosyltransferase (TDP-Fuc4NAc:lipidII transferase )

Gene Start:
1545016

Gene Stop:
1543919

Gene Length:
1098

Molecular Weight*:
42384

pI*:
10.40

Net Charge*:
19.07

EC:
 

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  
Energy metabolism; Sugars  

Pathway: pathway table

Secondary Evidence:
Danese PN, Oliver GR, Barr K, Bowman GD, Rick PD, Silhavy TJ.
Accumulation of the enterobacterial common antigen lipid II biosynthetic intermediate stimulates degP transcription in Escherichia coli.
J Bacteriol. 1998 Nov;180(22):5875-84.
PMID: 9811644

Comment:


Blast Summary:  PSI-Blast Search
Residues 5-354 are 49% similar to 20143889|sp|Q9L6Q8|WECF_SALTY 4-alpha-L-fucosyltransferase (TDP-Fuc4NAc:lipid II Fuc4NAc
transferase) (Fuc4NAc transferase).

Several hits in gapped BLAST to hypothetical proteins in E. coli and Salmonella typhimurium LT2; e.g., residues 5-354 are 47% similar to residues 1-347 of YIFM_ECOLI, a hypothetical 40.6 kD protein in the WZXE-WECF intergenic region; residues 5-358 are 49% similar to residues 1-351 of a protein sequence in S. typhimurium that is 83% similar to YIFM_ECOLI. Also strong hit to the N-terminal region of the E. coli sequence for 4-alpha-l-fucosyltransferase [836658]; residues 5-333 are 45% similar to residues 1-326 of the E. coli 4-alpha-l-fucosyltransferase.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 5-354 are 49% similar to a (IDENTITY 83% ZXE- ECF) protein domain (PD135769) which is seen in Q9L6Q8_BBBBB.



Paralogs:  Local Blast Search
HD1836 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 5 to 362 (E-value = 8.5e-127) place HD1836 in the Fuc4NAc_transf family which is described as 4-alpha-L-fucosyltransferase (Fuc4NAc transferase) (PF07429)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LRLAMNPIYHLLSSDIPQHNQSVLDFFQSQLLPVLADQQHIFYVVNQTRL
QEQYPALKLHCFNSKGAIAKAVLQVAKKEPNAQFILHGQYNVWLWCAILV
GKLPAYRCYWHIWGADLYQASTDWRFKLFYPLRRLAQQKFTHIWATRGDL
AYVAQHLARQKRDDRLVYFPTKMRSARWLAPPKEHNAATKITILLGNSGD
PANQHLTALTHIKQSLSAQSVKIIIPMGYPAHNQRYIQQVKQQAERLFPV
NTVQILTEKLSFTDYLALLQQCDLGYFNFTRQQGIGTLCLLIQLGIPCVL
HRQNPFTLDMDYEQIPFLYHDQLNVTAIRQTQRQLAKVDKQQIAFFAPNY
AKQWISLLTEVSQKQ$

Gene Nucleotide Sequence:  Sequence Viewer
TTGAGATTGGCTATGAACCCCATTTATCATCTGCTTAGTTCAGATATCCC
ACAGCATAACCAGAGTGTATTGGATTTTTTTCAATCACAGTTATTACCAG
TGTTAGCGGACCAACAACATATTTTTTATGTAGTTAATCAAACCCGTTTG
CAAGAACAATATCCCGCGTTAAAACTCCATTGTTTTAATAGCAAAGGCGC
GATTGCCAAAGCGGTGCTACAGGTTGCAAAAAAAGAGCCGAACGCACAAT
TTATCTTGCATGGTCAATATAATGTATGGCTATGGTGTGCAATTTTAGTT
GGAAAATTACCCGCTTATCGTTGCTATTGGCATATTTGGGGCGCAGATTT
ATATCAAGCATCAACAGATTGGCGGTTTAAATTATTTTATCCTCTTCGTC
GTTTAGCTCAACAAAAATTTACGCATATTTGGGCAACCCGTGGTGATTTA
GCTTATGTAGCGCAACACCTAGCTCGGCAAAAGCGTGATGATCGGCTGGT
GTATTTTCCGACAAAAATGAGATCAGCTAGGTGGTTAGCTCCTCCCAAAG
AGCACAATGCTGCAACAAAGATCACGATCTTGTTAGGGAATTCCGGTGAT
CCTGCTAATCAACATCTGACAGCATTAACGCACATTAAACAGAGTTTATC
AGCACAATCAGTGAAGATTATCATTCCTATGGGCTATCCAGCACATAATC
AACGTTATATTCAACAGGTAAAACAACAAGCTGAACGTTTATTCCCCGTA
AATACAGTGCAAATTTTGACTGAAAAATTATCATTTACCGATTATTTAGC
GTTGTTGCAACAATGTGATCTCGGCTATTTTAACTTTACCCGTCAACAAG
GGATCGGCACCCTTTGTTTACTAATACAATTGGGTATTCCTTGTGTGTTA
CACCGCCAAAATCCGTTCACCTTAGATATGGATTACGAACAGATTCCTTT
TTTGTATCATGATCAATTAAATGTTACCGCTATTCGCCAAACGCAACGCC
AACTTGCTAAGGTAGACAAACAGCAAATTGCCTTTTTTGCCCCCAATTAT
GCTAAACAGTGGATATCATTATTAACCGAGGTCAGTCAGAAACAATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy