Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-His-1 tRNA-Glu-2 tRNA-Pro-2 tRNA-Arg-3 rRNA-16S-5 rRNA-23S-5 IGR1353 IGR1355 IGR1354 IGR1352 HD1833 wzxE, - HD1838 rffA, - HD1840 wecC, - HD1842 wecF, - HD1835 HD1833 wzxE, - HD1838 rffA, - HD1840 wecC, - HD1842 wecF, - HD1835 HD1833 wzxE, - HD1838 rffA, - HD1840 wecF, - HD1835 wzxE, - HD1837 rffC, - HD1841 wecF, - HD1836 wzxE, - HD1837 wecF, - HD1836 wecC, - HD1842 rffC, - HD1841
* Calculated from Protein Sequence

Gene ID: HD1835

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
wecF  

Definition:
4-alpha-l-fucosyltransferase (TDP-Fuc4NAc:lipidII transferase )

Gene Start:
1543922

Gene Stop:
1542618

Gene Length:
1305

Molecular Weight*:
49753

pI*:
9.50

Net Charge*:
12.48

EC:
2.4.1.-  

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  
Energy metabolism; Sugars  

Pathway: pathway table
Biosynthesis and degradation of glycoprotein
Fructose and mannose metabolism
Glycerolipid metabolism
Peptideglycan biosynthesis
Sphingoglycolipid metabolism

Secondary Evidence:
Danese PN, Oliver GR, Barr K, Bowman GD, Rick PD, Silhavy TJ.
Accumulation of the enterobacterial common antigen lipid II biosynthetic intermediate stimulates degP transcription in Escherichia coli.
J Bacteriol. 1998 Nov;180(22):5875-84.
PMID: 9811644

Comment:


Blast Summary:  PSI-Blast Search
Residues 1-421 are 39% similar to 25511301 probable 4-alpha-L-fucosyltransferase - Yersinia pestis (strain CO92).

Otherwise, a few significant hits to probable 4-alpha-l-fucosyltransferases with gapped BLAST; e.g. residues 13-433 are 39% similar to residues 1-426 of WECF_ECOLI and residues 40-433 are 40% similar to residues 2-400 of WECF_SALTY. Also a strong hit to the C-terminal end of the E. coli sequence for 4-alpha-l-fucosyltransferase [836658]; residues 9-433 are 39% similar to residues 355-784 of this E. coli 4-alpha-l-fucosyltransferase.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 109-411 are 47% similar to a (TRANSFERASE GLYCOSYLTRANSFERASE) protein domain (PD042474) which is seen in Q9L6Q7_BBBBB.



Paralogs:  Local Blast Search
HD1835 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 433 (E-value = 3.1e-117) place HD1835 in the WzyE family which is described as WzyE protein (PF06899)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MMLVEYLLLSSCYICSACLMLSFIYKAYQHQQFSFHWLFSIIYFSTFYLG
FPCSMLLALLFDVTLPNYEMLLLTLLTALVSYLLYYFVYKRVNLIRQAVQ
KRQDFAKSEAILTASLLCMIGLFSLIAFISMNGLLIFKLEKYSQIFSSIV
QGIPLKRFFYFFIAGLLVFFFLYENKKTWLAFLLIGAFFGGFAYLAVGGT
RANLGLAIVLFLLLGLYKGYLSYKWLLFIGASMIGLMFLLALARYNLNVS
GREAFFTFLYLTRDTFSPWENVALLFIHPLEYQGLMPIVRDFYVYLPNWL
WADKPDQIVNTATYFTHQVLGNASALVISPTLLGSFYIMGGFTMIAIGMA
LTGLIIKLFDQLLAYAKQHIKHSSSAILQAYCFANLFNLIVLVRDGFDAF
CSRLVFFSLIFGCCWLVARAIDHIIINKHVVKEK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGTTAGTCGAATATCTCTTACTTAGTAGCTGTTATATATGCTCTGC
TTGTTTGATGTTATCTTTCATTTATAAAGCCTATCAGCATCAACAATTTT
CATTTCATTGGTTATTCAGTATTATTTATTTCAGTACCTTTTATCTAGGT
TTCCCGTGCTCAATGTTATTGGCATTGCTGTTTGATGTAACGCTACCTAA
CTATGAAATGTTATTACTCACCTTATTGACTGCGTTAGTGAGCTACTTAC
TGTATTACTTCGTTTATAAACGAGTAAATTTGATTCGACAAGCGGTACAG
AAAAGACAGGATTTTGCTAAATCAGAAGCTATTTTGACCGCTTCACTATT
GTGTATGATTGGACTATTTAGCTTAATCGCTTTTATCTCAATGAATGGCT
TGTTAATTTTTAAATTAGAAAAATATAGCCAAATCTTTTCTAGTATCGTA
CAAGGTATCCCACTAAAACGCTTTTTTTATTTTTTCATTGCCGGCTTGTT
AGTCTTCTTCTTCCTATATGAAAATAAAAAAACTTGGTTAGCATTTTTAT
TGATTGGCGCATTTTTTGGAGGTTTTGCCTATCTTGCAGTGGGCGGAACA
CGGGCTAACCTTGGTTTAGCGATCGTATTATTCTTATTATTAGGCCTTTA
TAAAGGCTATTTATCATATAAATGGTTGCTCTTCATCGGCGCCAGTATGA
TTGGCTTAATGTTTTTGCTTGCATTAGCGCGCTATAATTTGAATGTCAGT
GGGCGAGAAGCCTTTTTCACTTTCTTATATTTAACCAGAGATACCTTTTC
CCCTTGGGAAAACGTAGCCTTATTATTCATCCACCCGCTTGAATATCAAG
GTTTAATGCCGATCGTACGTGATTTTTATGTCTATTTACCCAATTGGCTC
TGGGCAGACAAACCCGATCAAATTGTGAATACCGCTACTTATTTTACACA
CCAAGTATTAGGCAACGCTTCAGCATTAGTCATCTCACCAACCTTATTAG
GTTCATTCTATATTATGGGTGGTTTTACAATGATAGCCATAGGTATGGCA
TTAACCGGGCTAATTATCAAACTTTTTGATCAACTATTAGCTTATGCTAA
ACAGCACATTAAACACAGCAGTTCAGCCATCTTACAAGCCTATTGCTTTG
CCAACCTATTTAACTTAATCGTATTAGTTCGTGATGGATTCGATGCCTTC
TGTTCCCGCTTGGTTTTCTTTAGCCTTATTTTTGGTTGCTGTTGGTTAGT
TGCGCGTGCAATAGACCACATCATCATAAACAAACACGTGGTGAAGGAAA
AATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy