Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-His-1 tRNA-Glu-2 tRNA-Pro-2 tRNA-Arg-3 rRNA-16S-5 rRNA-23S-5 IGR1353 IGR1354 IGR1352 HD1833 wzxE, - HD1838 rffA, - HD1840 wecF, - HD1835 HD1833 wzxE, - HD1838 rffA, - HD1840 wecF, - HD1835 HD1833 wzxE, - HD1838 rffA, - HD1840 wecF, - HD1835 wzxE, - HD1837 wecF, - HD1836 wzxE, - HD1837 wecF, - HD1836
* Calculated from Protein Sequence

Gene ID: HD1833

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
UDP-N-acetyl-D-mannosaminuronic acid transferase

Gene Start:
1542616

Gene Stop:
1541894

Gene Length:
723

Molecular Weight*:
27658

pI*:
10.50

Net Charge*:
12.96

EC:
 

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Sugar-nucleotide biosynthesis and conversions  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 3-240 are 51% similar to 16123990 probable
UDP-N-acetyl-D-mannosaminuronic acid transferase [Yersinia pestis].

Significant hits to putative UDP-N-acetyl-D-mannosamines and hypothetical proteins with gapped BLAST; e.g. residues 5-240 are 49% similar to probable UDP-N-acetyl-D-mannosamine (M95047) of Salmonella typhimurium, residues 6-240 are 47% similar to probable UDP-N-acetyl-D-mannosaminuronic acid transferase (AE000455) of E. coli, residues 35-240 are 32% similar to putuative lipopolysaccharide biosynthesis protein (AE001749) of Thermotoga maritima.

COGS Summary:  COGS Search
BeTs to 5 clades of COG1922
COG name: Teichoic acid biosynthesis proteins
Functional Class: M
The phylogenetic pattern of COG1922 is ------vCeb-------l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 35-224 are 55% similar to a (TRANSFERASE ACID PROTEOME COMPLETE) protein domain (PD007627) which is seen in WECG_SALTY.



Paralogs:  Local Blast Search
HD1833 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 54 to 225 (E-value = 6.2e-72) place HD1833 in the Glyco_tran_WecB family which is described as Glycosyl transferase WecB/TagA/CpsF family (PF03808)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MEKVAIRGIDILLAENKYSLANFLINQQTIRTGRLIAINAEKVIISEQQP
NLTALITQAEYKYADGISIIYAIKQKYPQLKTIERIPGVELWEILMQTAG
ELGIPVFLVGGTADTLAKVKQKLTAYHVNIVGYQNGYFQHEDELQIIQRI
QQSGAKLISVGMGTPKQELFIFKAHQHYPNALYMGVGGSYDVFIGKVKRA
PKIWQKFGLEWLYRLIKQPTRWRRQLNLLRFTYYYYTKQL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAAAAGTAGCAATACGGGGCATAGATATTCTGCTAGCAGAAAATAA
ATACAGTTTAGCTAATTTTTTAATCAATCAACAAACCATTAGAACCGGTA
GATTAATCGCAATTAATGCCGAGAAAGTGATTATTAGTGAACAACAACCA
AATTTAACCGCACTCATCACACAAGCTGAATATAAATATGCAGATGGAAT
AAGTATTATATATGCCATTAAACAGAAATATCCACAGTTAAAAACAATAG
AACGCATTCCCGGTGTTGAATTATGGGAAATCCTAATGCAGACCGCCGGA
GAATTAGGTATACCAGTTTTTTTAGTCGGAGGAACTGCAGACACATTAGC
AAAAGTTAAACAAAAATTGACCGCTTATCATGTTAATATCGTTGGCTACC
AAAACGGCTATTTTCAACATGAAGATGAACTACAAATTATTCAACGCATT
CAACAAAGCGGAGCAAAGTTAATTAGTGTTGGAATGGGAACACCAAAGCA
AGAATTATTTATATTCAAAGCTCATCAACACTATCCTAATGCACTGTATA
TGGGCGTTGGAGGTAGCTATGATGTTTTTATTGGCAAAGTAAAACGAGCA
CCTAAAATATGGCAAAAATTCGGCCTAGAATGGTTATATCGACTGATCAA
ACAACCAACACGTTGGCGTAGACAGCTCAACTTATTACGATTTACATATT
ACTATTATACAAAACAGCTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy