Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Glu-2 rRNA-5S-5 rRNA-16S-5 rRNA-23S-5 IGR1348 IGR1347 IGR1350 IGR1349 IGR1351 IGR1352 gptA, - HD1831 gmk, - HD1830 HD1829 HD1827 modC, - HD1826 pepD, - HD1832 gptA, - HD1831 gmk, - HD1830 HD1829 HD1827 modC, - HD1826 pepD, - HD1832 gptA, - HD1831 gmk, - HD1830 HD1829 modC, - HD1826 pepD, - HD1832 HD1828 HD1827 HD1828
* Calculated from Protein Sequence

Gene ID: HD1832

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
pepD  

Definition:
aminoacyl-histidine dipeptidase

Gene Start:
1534455

Gene Stop:
1535903

Gene Length:
1449

Molecular Weight*:
53408

pI*:
6.20

Net Charge*:
-8.16

EC:
3.4.13.3  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table
Alanine and aspartate metabolism
Arginine and proline metabolism
beta-Alanine metabolism
Histidine metabolism

Secondary Evidence:
Henrich B, Monnerjahn U, Plapp R.
Peptidase D gene (pepD) of Escherichia coli K-12: nucleotide sequence, transcript mapping, and comparison with other peptidase genes.
J Bacteriol 1990 Aug;172(8):4641-51.
Medline: 90330577

Comment:
For other "pep" genes, see HD1169 (pepB), HD0555 (pepA), HD0976 (pepN).

Blast Summary:  PSI-Blast Search
Numerous hits to aminoacyl-histidine dipeptidases (pepD) with are gapped BLAST; e.g. residues 1-179 are 60% similar to pepD (U32750) of Haemophilus influenzae, residues 1-480 are 53% similar to pepD precursor (D83536) of E. coli, residues 16-482 are 28% similar to putative peptidase (AL139076) of Campylobacter jejuni.

COGS Summary:  COGS Search
BeTs to 3 clades of COG2195
COG name: Di- and tripeptidases
Functional Class: E
The phylogenetic pattern of COG2195 is --------EB-H----o----
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** PR00934 (X-His dipeptidase (M25) signature) with a combined E-value of 7.1e-95.
    PR00934A    80-99
    PR00934B    101-119
    PR00934C    135-152
    PR00934D    159-177
    PR00934E    205-222
    PR00934F    250-269
    PR00934G    362-380
    PR00934H    427-443
    PR00934I    449-471


ProDom Summary:  Protein Domain Search
Residues 18-134 are 77% similar to a (COMPLETE PROTEOME HYDROLASE DESUCCINYLASE) protein domain (PD001449) which is seen in PEPD_HAEIN.

Residues 82-135 are 79% similar to a (DIPEPTIDASE PROTEOME MANGANESE COMPLETE) protein domain (PD411906) which is seen in Q9CL74_PASMU.

Residues 137-468 are 56% similar to a (DIPEPTIDASE COMPLETE PROTEOME) protein domain (PD024579) which is seen in Q9CL74_PASMU.



Paralogs:  Local Blast Search
HD1832 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 16 to 481 (E-value = 2e-40) place HD1832 in the Peptidase_M20 family which is described as Peptidase family M20/M25/M40 (PF01546)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MSEISKLTPNILWQWFDQICTIPHPSYHEEKLANFIVNWAKSKQLFVERD
EVGNILIRKPATKGMENRQSIALQAHLDMVPQANPSTIHDFSKDPIQPYI
DGDWVKAKGTTLGADNGIGLASCLAVLESKALIHPTIEVLLTMSEEVGME
GVLGLRPNWLQSNIMINTDTEDNGEIYIGCAGGENINLTLPLEYQPTQFD
CTYHISLKGLKGGHSGCDIHTTRANAIKLLTRLLADLASQHTIHIANITG
GSVRNAIPRNAQTTITFKAKDQQELTAYLTQLTTEISNELKLAEPNLEFI
IEQIDLPQQTLTHESTQKMIHLLNLLPNGVIRNSDIIENVVETSLSIGLI
KIEDQHLTANILVRSLLESGKAEVRSKINSLATLTDAKVTYSGDYPSWQP
NINSKITSLTKKIYDQILGYEAKIKVIHAGLECGLIKQIYPHMDIVSIGP
TIKNAHSPDEKVHIPAVETYWQLLTTLLSKAA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCAGAAATATCTAAACTCACTCCCAATATACTATGGCAATGGTTTGA
TCAAATTTGTACTATTCCCCATCCTTCTTACCATGAAGAAAAACTCGCAA
ACTTTATTGTCAATTGGGCAAAATCTAAACAGCTTTTTGTGGAACGTGAT
GAAGTAGGCAATATTCTTATACGTAAGCCAGCCACTAAAGGAATGGAAAA
TCGACAATCCATTGCATTACAAGCACATTTAGATATGGTGCCACAAGCAA
ATCCATCCACCATACATGACTTCTCTAAAGATCCTATTCAGCCCTATATT
GATGGCGACTGGGTTAAAGCTAAAGGAACTACATTAGGTGCTGATAATGG
CATTGGATTAGCATCTTGCCTCGCTGTTTTAGAAAGTAAAGCGCTTATAC
ATCCAACTATCGAAGTATTACTGACAATGAGCGAAGAAGTTGGAATGGAA
GGTGTCTTAGGACTCCGCCCTAACTGGCTTCAATCAAATATTATGATTAA
CACCGACACTGAAGATAATGGTGAAATCTATATCGGTTGTGCAGGCGGTG
AAAATATTAATTTAACTTTACCGCTAGAATATCAACCAACTCAATTTGAT
TGTACTTACCATATCAGTTTAAAAGGTTTAAAAGGCGGCCACTCTGGTTG
TGATATCCATACAACTAGAGCAAATGCAATTAAACTACTGACACGCTTAC
TCGCTGATCTTGCAAGCCAACATACTATTCATATCGCAAATATAACCGGT
GGTTCCGTGCGTAACGCAATACCACGAAATGCGCAAACAACGATTACATT
CAAAGCCAAAGATCAACAAGAATTAACCGCTTACTTAACGCAATTAACTA
CTGAAATTAGTAACGAACTAAAATTAGCTGAGCCTAATTTAGAATTCATA
ATAGAACAGATTGATTTACCACAACAAACACTCACGCATGAATCGACCCA
AAAAATGATTCACCTACTGAATCTATTACCCAATGGCGTTATTCGCAATA
GCGATATTATTGAAAATGTCGTCGAAACATCCTTAAGCATTGGACTAATA
AAAATTGAAGATCAACACTTAACAGCAAATATTCTAGTCCGTTCTTTACT
AGAAAGCGGTAAAGCAGAAGTCCGTAGTAAAATTAATTCATTAGCTACAT
TGACTGACGCAAAAGTCACCTATAGCGGAGATTACCCTAGTTGGCAGCCT
AATATAAATTCAAAAATCACATCGCTTACCAAAAAAATTTATGATCAAAT
TTTAGGCTACGAAGCAAAAATTAAAGTCATTCATGCAGGCCTAGAATGTG
GTTTAATTAAACAAATATATCCCCATATGGATATTGTGTCTATTGGACCG
ACTATCAAAAATGCACATTCACCAGATGAAAAAGTACATATTCCAGCGGT
AGAAACCTATTGGCAACTACTCACTACTTTACTTTCAAAAGCCGCCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy