Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap rRNA-5S-5 rRNA-23S-5 IGR1348 IGR1347 IGR1350 IGR1349 IGR1351 IGR1352 gptA, - HD1831 gmk, - HD1830 HD1829 HD1827 modB, - HD1824 modC, - HD1826 pepD, - HD1832 gptA, - HD1831 gmk, - HD1830 HD1829 HD1827 modB, - HD1824 modC, - HD1826 pepD, - HD1832 gptA, - HD1831 gmk, - HD1830 HD1829 modB, - HD1824 modC, - HD1826 pepD, - HD1832 HD1825 HD1828 HD1827 HD1825 HD1828
* Calculated from Protein Sequence

Gene ID: HD1831

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
gptA  

Definition:
xanthine-guanine phosphoribosyltransferase

Gene Start:
1534283

Gene Stop:
1533810

Gene Length:
474

Molecular Weight*:
17737

pI*:
6.40

Net Charge*:
-1.85

EC:
2.4.2.22  2.4.2.8  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Salvage of nucleosides and nucleotides  

Pathway: pathway table
Purine metabolism

Secondary Evidence:
Gershanovitch VN, Yourovitskaya NV, Komissarova LV, Bolshakova TN, Erlagaeva RS, Bourd GI.
Catabolite repression in Escherichia coli K12 mutants defective in glucose transport.
Mol Gen Genet. 1975 Sep 15;140(1):81-90.
PMID: 1102954

Jardim A, Bergeson SE, Shih S, Carter N, Lucas RW, Merlin G, Myler PJ, Stuart K, Ullman B.
Xanthine phosphoribosyltransferase from Leishmania donovani. Molecular cloning, biochemical characterization, and genetic analysis.
J Biol Chem. 1999 Nov 26;274(48):34403-10.
PMID: 10567419


Comment:
0

Blast Summary:  PSI-Blast Search
Significant hits to xanthine phosphoribosyltransferases (gptB) with gapped BLAST; e.g. residues 7-157 are 81% similar to gptB (U32752) of Haemophilus influenzae, residues 7-155 are 73% similar to Xanthine-guanine phosphoribosyltransferase (D83536) of E. coli, residues 7-155 are 75% similar to xanthine-guanine phosphoribosyltransferase (U28239) of Salmonella typhimurium.

COGS Summary:  COGS Search
BeTs to 3 clades of COG2236
COG name: Predicted phosphoribosyltransferases
Functional Class:  R
The phylogenetic pattern of COG2236 is A--KY-------uj--ol---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 12-145 are 76% similar to a (TRANSFERASE PHOSPHORIBOSYLTRANSFERASE) protein domain (PD000249) which is seen in XGPT_ECOLI.

Residues 7-36 are 86% similar to a (SALVAGE PROTEOME GLYCOSYLTRANSFERASE) protein domain (PD021792) which is seen in Q9CL73_PASMU.



Paralogs:  Local Blast Search
HD1831 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 6 to 135 (E-value = 6.7e-18) place HD1831 in the Pribosyltran family which is described as Phosphoribosyl transferase domain (PF00156)

PDB Hit:
pdb|1A96|C Chain C, Xprtase From E. Coli With Bound Cprpp And X... 246 1e-066
pdb|1A98|B Chain B, Xprtase From E. Coli Complexed With Gmp >gi... 242 2e-065
pdb|1A97|B Chain B, Xprtase From E. Coli Complexed With Gmp >gi... 242 2e-065

Gene Protein Sequence:
MSGKYTNEKYVVTWDMFHMHTRKLAERLLPASQWKGIIAVSRGGLFPAAV
LARELSIRHVETVCISSYEHDEQGELKVLHAAQTDGEGFIVVDDLVDTGN
TAKEIRRMYPKAKFVTVFAKPLGAPLIDDYVIDIPQETWIEQPWDLGITF
VPPLARK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTGGAAAATACACAAACGAAAAATATGTGGTGACGTGGGATATGTT
TCATATGCATACCCGTAAATTAGCAGAACGTCTTTTGCCTGCGTCACAAT
GGAAAGGTATTATCGCAGTTAGTCGTGGAGGTTTATTTCCAGCAGCGGTC
TTAGCACGGGAATTAAGTATTCGCCACGTAGAAACTGTATGTATTTCAAG
TTATGAACATGATGAACAAGGCGAATTAAAAGTGTTACACGCAGCACAAA
CAGATGGTGAGGGTTTTATCGTTGTAGATGATTTAGTGGATACGGGGAAT
ACTGCGAAAGAAATTCGTAGAATGTATCCAAAGGCAAAATTTGTGACTGT
TTTTGCTAAACCACTTGGTGCGCCGCTTATTGATGATTATGTTATTGATA
TTCCTCAAGAAACGTGGATTGAGCAACCTTGGGATTTAGGCATTACCTTT
GTTCCTCCGCTTGCTCGTAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy