Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap rRNA-5S-5 rRNA-23S-5 IGR1348 IGR1347 IGR1350 IGR1346 IGR1349 IGR1351 IGR1352 gptA, - HD1831 gmk, - HD1830 HD1829 HD1827 modB, - HD1824 modA, - HD1823 modC, - HD1826 pepD, - HD1832 gptA, - HD1831 gmk, - HD1830 HD1829 HD1827 modB, - HD1824 modA, - HD1823 modC, - HD1826 pepD, - HD1832 gptA, - HD1831 gmk, - HD1830 HD1829 modB, - HD1824 modA, - HD1823 modC, - HD1826 pepD, - HD1832 HD1825 HD1828 HD1827 HD1825 HD1828
* Calculated from Protein Sequence

Gene ID: HD1830

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
gmk  

Definition:
5'-guanylate kinase

Gene Start:
1533741

Gene Stop:
1533121

Gene Length:
621

Molecular Weight*:
23463

pI*:
6.10

Net Charge*:
-4.07

EC:
2.7.4.8  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
Purine metabolism

Secondary Evidence:
Gentry,D., Bengra,C., Ikehara,K. and Cashel,M.
Guanylate kinase of Escherichia coli K-12.
J. Biol. Chem. 268 (19), 14316-14321 (1993)
Medline: 93300828.

Comment:
0

Blast Summary:  PSI-Blast Search
Numerous hits to guanylate kinases with gapped BLAST; e.g. residues 3-206 are 63% similar to guanylate kinase (M84400) of E. coli, residues 3-206 are 65% similar to guanylate kinase (U32848) of Haemophilus influenzae, residues 3-206 are 63% similar to guanylate kinase (AF140283) of Salmonella typhimurium, residues 3-204 are 48% similar to guanylate kinase (AL162757) of Neisseria meningitidis.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0194
COG name: Guanylate kinase
Functional Class:  F
The phylogenetic pattern of COG0194 is ----yqvcEbrhujgp--inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000619 (Guanylate kinase) with a combined E-value of 2.4e-45.
    IPB000619A    6-23
    IPB000619B    36-57
    IPB000619C    59-111


ProDom Summary:  Protein Domain Search
Residues 110-190 are 65% similar to a (KINASE TRANSFERASE GUANYLATE GMP) protein domain (PD003452) which is seen in KGUA_ECOLI.

Residues 7-108 are 69% similar to a (KINASE GUANYLATE TRANSFERASE ATP-BINDING) protein domain (PD001338) which is seen in KGUA_HAEIN.

Residues 119-185 are 44% similar to a (KINASE GUANYLATE TRANSFERASE ATP-BINDING) protein domain (PD415575) which is seen in KGUA_UREPA.



Paralogs:  Local Blast Search
HD1830 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 40 to 144 (E-value = 3.7e-44) place HD1830 in the Guanylate_kin family which is described as Guanylate kinase (PF00625)

PDB Hit:
pdb|1GKY| Guanylate Kinase (E.C.2.7.4.8) Complex With Guanos... 132 4e-032

Gene Protein Sequence:
MLGNLYILSAPSGAGKSSLINALLADLPRTEVQLSISHTTRQPRVGETHG
IHYYFTEHHEFESLIEQGHFLEWARVFDHYYGTSLPMIERSLAQGIDVFL
DIDWQGARQIREKVPNVKTIFILPPSRAELEKRLVGRGQDSLETIAKRME
QAVSEMTHYNEFDYVIINDQFKTALTELKSILTAERLKQSAQAIRQQALI
AELLAE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTAGGCAATCTATATATACTTTCAGCACCCAGCGGAGCGGGTAAATC
TTCGTTAATAAATGCATTACTTGCAGATTTACCTCGTACAGAAGTGCAGC
TTTCAATTTCACATACAACGCGTCAGCCACGTGTAGGGGAGACGCATGGT
ATCCATTATTATTTTACCGAGCATCACGAATTTGAATCGTTGATTGAACA
AGGTCATTTTTTAGAATGGGCAAGAGTATTTGATCATTATTATGGTACGT
CATTGCCGATGATTGAGCGTAGCTTGGCGCAAGGTATTGATGTATTTTTA
GATATTGATTGGCAAGGTGCTCGCCAAATCCGTGAAAAAGTGCCTAATGT
AAAAACTATTTTTATTTTGCCTCCATCGCGCGCTGAATTAGAAAAGCGTT
TAGTCGGGCGAGGGCAAGATTCTTTAGAAACTATTGCTAAACGGATGGAA
CAAGCGGTATCAGAAATGACTCATTACAATGAGTTTGATTATGTCATTAT
TAATGATCAGTTTAAAACCGCATTAACTGAATTAAAAAGTATTCTTACTG
CGGAACGTTTAAAACAATCAGCACAAGCTATTCGCCAACAAGCATTAATT
GCTGAATTATTAGCTGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy