Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap rRNA-5S-5 rRNA-23S-5 IGR1344 IGR1348 IGR1347 IGR1350 IGR1346 IGR1345 IGR1349 IGR1351 IGR1352 gptA, - HD1831 gmk, - HD1830 HD1829 HD1827 modB, - HD1824 modA, - HD1823 yadH, - HD1821 yadG, - HD1820 modC, - HD1826 pepD, - HD1832 gptA, - HD1831 gmk, - HD1830 HD1829 HD1827 modB, - HD1824 modA, - HD1823 yadH, - HD1821 yadG, - HD1820 modC, - HD1826 pepD, - HD1832 gptA, - HD1831 gmk, - HD1830 HD1829 modB, - HD1824 modA, - HD1823 yadG, - HD1820 modC, - HD1826 pepD, - HD1832 HD1825 HD1828 HD1827 HD1825 yadH, - HD1821 HD1828
* Calculated from Protein Sequence

Gene ID: HD1829

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
probable outer membrane protein

Gene Start:
1533008

Gene Stop:
1531602

Gene Length:
1407

Molecular Weight*:
52329

pI*:
9.40

Net Charge*:
4.94

EC:
 

Functional Class:
Cell envelope; Membranes, lipoproteins, and porins  

Pathway: pathway table

Comment:
0

Blast Summary:  PSI-Blast Search
Signficant hits to hypothetical / putative outer membrane proteins with gapped BLAST; e.g. residues 10-465 are 48% similar to hypothetical protein (U32824) of Haemophilus influenzae, residues 5-462 are 30% similar to putative outer membrane protein (AL139075) of Campylobacter jejuni, residues 52-467 are 22% simialr to IbeB protein (AF094824) of E. coli, residues 10-467 are 21% similar to putative outer membrane protein (AL162757) of Neisseria meningititis.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 10-76 are 46% similar to a (MEMBRANE OUTER PRECURSOR LIPOPROTEIN) protein domain (PD013861) which is seen in Q9CNA5_PASMU.

Residues 286-465 are 57% similar to a (HI1340 HI1462) protein domain (PD155780) which is seen in YD40_HAEIN.

Residues 286-451 are 52% similar to a (COMPLETE PROTEOME MEMBRANE OUTER) protein domain (PD009918) which is seen in Q9CNA5_PASMU.

Residues 77-284 are 45% similar to a (PROTEOME COMPLETE MEMBRANE HI1340) protein domain (PD155781) which is seen in Q9CNA5_PASMU.



Paralogs:  Local Blast Search


HD1829 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 61 to 255 (E-value = 1.2e-29) place HD1829 in the OEP family which is described as Outer membrane efflux protein (PF02321)
Residues 282 to 462 (E-value = 1.8e-23) place HD1829 in the OEP family which is described as Outer membrane efflux protein (PF02321)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MKFSKLALFITLASFLSACTSSMTKDGSLEQAKTSYQQYEELTKQFNIDE
EWWKGYNDPQLNRLVSQALANNVNLAKSAILVNKALYNANLVGASLVPTF
SGSGSSSASKLLVSDGSLQSSNSVTKASNVVHNASFNLSYTLDLWRRLAD
SASASEWEYKATIEDLKATRLSIINAVVASYYQIAYLKDVINVSEQTIKN
YEQINHILENKMEVGAIDHLAVEQAKQATLNARNGLIGYRTTLKVAEQTL
RNLLNLKPNEPLPIEYPAILSVELQGVDMNVPISAIANRPDVAAKLKRLQ
SAFKSLSATEKSWFPTVTLGASISSSAAKLRNIGDNQLGNSMISLNLPFL
DWQTVKNNVKLSEADYRLAKLNYEQVITSALNEVDNYYYAYQQAFDSYST
LQQVYEHNKKISFYYKNRYELGVAEFREWVNAMNVELTSQLAILNQKYTI
LAKENAVYQSMAGKYKRL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATTTTCAAAATTAGCGTTATTTATTACGTTAGCAAGCTTTTTGTC
AGCTTGTACATCGAGTATGACAAAAGATGGCTCGCTTGAACAAGCAAAAA
CCAGCTACCAGCAATATGAAGAATTGACTAAGCAGTTTAATATTGATGAA
GAATGGTGGAAAGGGTATAACGATCCGCAGTTAAATCGTCTTGTTAGCCA
AGCCTTAGCTAATAATGTTAACTTAGCCAAAAGTGCTATTTTGGTTAATA
AAGCGCTATATAATGCGAATTTAGTTGGTGCTAGTTTAGTACCAACTTTT
AGTGGTAGTGGTTCAAGCTCGGCATCAAAATTGTTGGTTTCTGATGGCTC
ATTACAATCATCTAATAGCGTTACCAAGGCGTCAAATGTTGTACACAATG
CCTCATTCAATTTAAGTTATACGCTTGATTTATGGCGTCGTTTAGCTGAT
AGTGCTAGTGCGTCGGAATGGGAATATAAAGCAACGATAGAAGACTTAAA
AGCAACTCGACTTTCTATTATTAATGCCGTTGTGGCTAGCTATTATCAAA
TTGCCTATTTGAAAGATGTGATTAATGTTAGTGAACAAACCATTAAAAAT
TATGAACAGATTAATCATATTCTAGAAAATAAAATGGAAGTGGGGGCAAT
TGATCACTTAGCGGTTGAACAAGCCAAGCAAGCGACTTTGAATGCACGTA
ATGGTTTGATTGGCTATCGTACTACTCTAAAAGTGGCGGAACAAACCTTA
CGTAACTTATTGAATTTAAAGCCAAATGAGCCTTTGCCAATAGAGTACCC
AGCGATTTTGTCAGTTGAATTGCAAGGGGTTGATATGAATGTACCTATTT
CAGCTATCGCAAATCGTCCAGATGTAGCGGCAAAATTAAAACGTTTGCAA
TCGGCATTTAAATCATTAAGTGCGACGGAAAAAAGTTGGTTCCCGACGGT
TACATTAGGCGCTTCAATTTCAAGTAGTGCGGCTAAATTAAGGAATATTG
GTGATAATCAATTAGGCAATAGTATGATTTCATTGAATTTGCCATTCCTA
GATTGGCAAACCGTCAAAAATAATGTGAAGCTTTCGGAAGCGGATTATCG
TTTGGCAAAATTGAATTATGAGCAAGTCATTACATCCGCATTAAATGAAG
TGGATAATTACTATTATGCTTATCAACAGGCCTTTGATAGTTATAGCACT
TTGCAACAAGTGTATGAACATAATAAGAAAATTAGTTTTTATTATAAAAA
TCGCTATGAGTTAGGTGTTGCTGAATTTCGTGAATGGGTTAACGCGATGA
ATGTAGAATTAACTTCTCAGTTAGCCATTTTGAATCAAAAATATACTATT
TTGGCCAAAGAAAATGCCGTTTATCAATCAATGGCAGGTAAATATAAACG
GTTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy