Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1344 IGR1348 IGR1347 IGR1350 IGR1346 IGR1345 IGR1349 IGR1351 gptA, - HD1831 gmk, - HD1830 HD1829 HD1827 modB, - HD1824 modA, - HD1823 yadH, - HD1821 yadG, - HD1820 modC, - HD1826 pepD, - HD1832 dnaX, - HD1819 gptA, - HD1831 gmk, - HD1830 HD1829 HD1827 modB, - HD1824 modA, - HD1823 yadH, - HD1821 yadG, - HD1820 modC, - HD1826 pepD, - HD1832 dnaX, - HD1819 gptA, - HD1831 gmk, - HD1830 HD1829 modB, - HD1824 modA, - HD1823 yadH, - HD1821 yadG, - HD1820 modC, - HD1826 pepD, - HD1832 dnaX, - HD1819 HD1825 HD1828 HD1827 HD1825 HD1828
* Calculated from Protein Sequence

Gene ID: HD1826

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
modC  

Definition:
molybdenum ABC transporter, ATP-binding protein

Gene Start:
1529731

Gene Stop:
1530786

Gene Length:
1056

Molecular Weight*:
39461

pI*:
9.00

Net Charge*:
5.57

EC:
 

Functional Class:
Transport and binding proteins; ABC Superfamily: ATP-binding protein  

Pathway: pathway table

Secondary Evidence:
Maupin-Furlow,J.A., Rosentel,J.K., Lee,J.H., Deppenmeier,U.,
Gunsalus,R.P. and Shanmugam,K.T.
Genetic analysis of the modABCD (molybdate transport) operon of
Escherichia coli
J. Bacteriol. 177 (17), 4851-4856 (1995)
Medline: 95394784

Walkenhorst,H.M., Hemschemeier,S.K. and Eichenlaub,R.
Molecular analysis of the molybdate uptake operon, modABCD, of
Escherichia coli and modR, a regulatory gene
Microbiol. Res. 150 (4), 347-361 (1995)
Medline: 96151473

Self WT, Grunden AM, Hasona A, Shanmugam KT.
Molybdate transport.
Res Microbiol. 2001 Apr-May;152(3-4):311-21. Review.
PMID: 11421278

Grunden AM, Shanmugam KT.
Molybdate transport and regulation in bacteria.
Arch Microbiol. 1997 Nov;168(5):345-54. Review.
PMID: 9325422



Comment:
For other components see HD1820 (NBD1); HD1824 (MSD1); HD1821 (MSD2) and HD1823 (SBP1).

This protein is part of the binding-protein-dependent transport system for molybdenum.It is probably responsible for energy coupling to the transport system.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to molybdenum transport ATP-binding protein sequences,e.g.residues 1-351 are 55% similar to molybdenum transport ATP-binding protein in Haemophilus influenzae strain Rd KW20 (1170991|).

Residues 1-351 are 48% similar to molybdenum transport ATP-binding protein in Escherichia coli (1709069|).

COGS Summary:  COGS Search
BeTs to 5 clades of COG1118
COG name: ABC-type sulfate/molybdenum transport system, ATPase component
Functional Class: P
The phylogenetic pattern of COG1118 is amtk---cE-rH-------n-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB001140 (ABC transporter transmembrane region) with a combined E-value of 2.7e-30.
    IPB001140A    13-59
    IPB001140B    126-164
    IPB001140C    182-211


ProDom Summary:  Protein Domain Search
Residues 75-126 are 67% similar to a (ATP-BINDING TRANSPORT COMPLETE PROTEOME TRANSPORTER ABC) protein domain (PD007166) which is seen in Q9CMS0_PASMU.

Residues 244-351 are 53% similar to a (MOLYBDENUM ATP-BINDING TRANSPORT MEMBRANE) protein domain (PD019446) which is seen in MODC_HAEIN.

Residues 174-219 are 50% similar to a (PROTEOME COMPLETE ATP-BINDING MOLYBDENUM) protein domain (PD258383) which is seen in Q9CMS0_PASMU.

Residues 128-171 are 86% similar to a (ATP-BINDING TRANSPORT ABC TRANSPORTER COMPLETE PROTEOME) protein domain (PD000006) which is seen in Q9CMS0_PASMU.



Paralogs:  Local Blast Search
HD1826 is paralogously related to HD0572 (6e-31), HD0231 (6e-31), HD1098 (1e-25), HD1019 (5e-25), HD2032 (7e-25), HD0860 (8e-24), HD0811 (3e-23), HD1672 (1e-20), HD0982 (1e-19), HD1338 (2e-19), HD1652 (1e-18), HD0863 (4e-18), HD0586 (8e-18), HD1630 (1e-17), HD0259 (3e-17), HD1817 (7e-17), HD0316 (9e-17), HD1671 (6e-16), HD0315 (7e-16), HD1820 (8e-15), HD1745 (1e-14), HD1235 (5e-11), HD1651 (1e-10), HD1768 (3e-10), HD0224 (4e-10), HD0786 (7e-08) and HD1286 (6e-05).


Pfam Summary:  Pfam Search
Residues 24 to 205 (E-value = 8.3e-57) place HD1826 in the ABC_tran family which is described as ABC transporter (PF00005)
Residues 291 to 351 (E-value = 1.8e-09) place HD1826 in the TOBE family which is described as TOBE domain (PF03459)

PDB Hit:
pdb|1G29|1 Chain 1, Malk >gi|12084695|pdb|1G29|2 Chain 2, Malk 140 2e-034
pdb|1B0U|A Chain A, Atp-Binding Subunit Of The Histidine Permea... 90 3e-019

Gene Protein Sequence:
MLEINIHQQLGSLNLTVNLHIAAKGVTAILGRSGAGKSSLINLIAGLTTA
QRGYIKLGEQTLYDHEQGINLAPEKRHIGYVFQEHRLFPHYSVAKNLKYG
CKRVDNAHFLQIVKLLGIEHLLNRYPSSLSGGEKQRVAIGRALLTKPQIL
LMDEPLSALDLPRKQELITYLSQLANQVDIPILYVTHSLDEIIRLADQLI
LLEQGKIIAFDLVVNVWHSDILADWQSETQKISLLELPLNIQQPIYKMVG
LKLGKQHIWIPATPHYKIGDKLRITIASKDVSISLDQVQHSSIRNILNGV
ITQIVEHNDRVDIAVLIETHQIWASISLWSFDELALKIGQQIYVQIKSVS
L$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTTGAAATTAATATTCATCAACAATTAGGTTCACTAAATTTAACGGT
AAACTTACACATTGCGGCTAAAGGCGTTACGGCTATCTTAGGTCGTTCTG
GTGCTGGAAAATCCAGTTTAATCAATCTAATTGCGGGGCTGACTACAGCA
CAACGCGGATATATTAAACTGGGTGAGCAAACACTGTATGATCATGAACA
AGGTATTAATCTTGCGCCAGAAAAACGTCATATAGGCTATGTATTTCAAG
AACATAGACTCTTCCCACATTATTCCGTAGCCAAAAACCTTAAATATGGC
TGTAAGCGGGTGGATAATGCTCATTTCTTGCAAATTGTGAAATTATTGGG
GATTGAACATTTACTTAATCGTTATCCAAGCAGTCTTTCAGGCGGTGAAA
AACAGCGTGTCGCAATCGGACGAGCATTATTAACTAAACCACAAATTTTA
CTCATGGATGAACCGCTATCTGCCCTTGATTTACCTCGTAAACAAGAATT
AATCACTTACTTAAGTCAATTAGCAAATCAAGTAGACATTCCGATTCTAT
ATGTCACTCATAGTTTAGATGAAATTATTCGTTTAGCCGATCAGCTTATC
TTACTTGAACAAGGTAAGATTATCGCTTTTGACTTGGTTGTTAATGTATG
GCATAGCGATATTTTAGCTGATTGGCAATCAGAGACACAAAAAATAAGCT
TATTAGAATTACCCTTGAATATACAACAGCCTATTTATAAAATGGTGGGC
TTAAAACTAGGTAAACAACATATTTGGATCCCAGCAACACCTCATTATAA
AATAGGTGATAAACTTAGGATTACCATTGCAAGCAAAGATGTTTCGATTA
GTTTAGATCAAGTGCAACACAGCTCAATTAGAAATATTCTCAACGGCGTT
ATTACTCAAATTGTAGAACACAATGATCGGGTAGATATTGCAGTCTTGAT
TGAAACACATCAAATTTGGGCATCAATTAGCTTGTGGTCATTTGATGAAC
TCGCACTAAAAATTGGCCAACAAATTTATGTACAGATTAAAAGTGTTTCT
TTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy