Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1344 IGR1348 IGR1347 IGR1350 IGR1346 IGR1345 IGR1349 IGR1351 gptA, - HD1831 gmk, - HD1830 HD1829 HD1827 modB, - HD1824 modA, - HD1823 yadH, - HD1821 yadG, - HD1820 modC, - HD1826 dnaX, - HD1819 gptA, - HD1831 gmk, - HD1830 HD1829 HD1827 modB, - HD1824 modA, - HD1823 yadH, - HD1821 yadG, - HD1820 modC, - HD1826 dnaX, - HD1819 gptA, - HD1831 gmk, - HD1830 HD1829 modB, - HD1824 modA, - HD1823 yadH, - HD1821 yadG, - HD1820 modC, - HD1826 dnaX, - HD1819 HD1825 HD1828 HD1827 HD1825 HD1828
* Calculated from Protein Sequence

Gene ID: HD1824

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
modB  

Definition:
molybdenum ABC transporter, permease protein

Gene Start:
1529020

Gene Stop:
1529712

Gene Length:
693

Molecular Weight*:
25334

pI*:
10.70

Net Charge*:
7.18

EC:
 

Functional Class:
Transport and binding proteins; ABC Superfamily: membrane spanning permease  

Pathway: pathway table

Secondary Evidence:
Maupin-Furlow,J.A., Rosentel,J.K., Lee,J.H., Deppenmeier,U.,
Gunsalus,R.P. and Shanmugam,K.T.
Genetic analysis of the modABCD (molybdate transport) operon of
Escherichia coli
J. Bacteriol. 177 (17), 4851-4856 (1995)
Medline: 95394784

Walkenhorst,H.M., Hemschemeier,S.K. and Eichenlaub,R.
Molecular analysis of the molybdate uptake operon, modABCD, of
Escherichia coli and modR, a regulatory gene
Microbiol. Res. 150 (4), 347-361 (1995)
Medline: 96151473

Self WT, Grunden AM, Hasona A, Shanmugam KT.
Molybdate transport.
Res Microbiol. 2001 Apr-May;152(3-4):311-21. Review.
PMID: 11421278

Grunden AM, Shanmugam KT.
Molybdate transport and regulation in bacteria.
Arch Microbiol. 1997 Nov;168(5):345-54. Review.
PMID: 9325422



Comment:
For other components see HD1820 (NBD1); HD1826 (NBD2); HD1821 (MSD2) and HD1823 (SBP1).

This protein is part of the binding-protein-dependent transport system for molybdenum.It is probably responsible for the translocation of the substrate across the membrane.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to molybdenum transport protein sequences,e.g.residues 34-252 are 63% similar to molybdenum transport protein in Haemophilus influenzae strain Rd
KW20 (1170989|).

Residues 31-248 are 62% similar to molybdenum transport protein in Escherichia coli (585496|).

COGS Summary:  COGS Search
BeTs to 10 clades of COG0555
COG name: ABC-type cysteine/molybdate transport systems, permease components
Functional Class: E,P
The phylogenetic pattern of COG0555 is amTk-q-CEbRHuj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000515 (Binding-protein-dependent transport systems inner membrane component) with a combined E-value of 6.8e-08.
    IPB000515    129-148


ProDom Summary:  Protein Domain Search
Residues 15-103 are 40% similar to a (TRANSPORT PERMEASE COMPLETE PROTEOME TRANSMEMBRANE) protein domain (PD002244) which is seen in Q9X8Y7_STRCO.

Residues 113-224 are 67% similar to a (TRANSPORT PERMEASE COMPLETE PROTEOME TRANSMEMBRANE) protein domain (PD349044) which is seen in Q9KLL8_VIBCH.

Residues 52-112 are 63% similar to a (TRANSPORT MOLYBDENUM PROTEOME COMPLETE) protein domain (PD229979) which is seen in Q9KLL8_VIBCH.



Paralogs:  Local Blast Search
HD1824 is paralogously related to HD0573 (2e-11), HD0574 (5e-11), HD0230 (9e-07), HD1099 (6e-06) and HD0813 (0.001).


Pfam Summary:  Pfam Search
Residues 12 to 230 (E-value = 1.5e-18) place HD1824 in the BPD_transp_1 family which is described as Binding-protein-dependent transport system inner membrane component (PF00528)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MLSSMFNFTPQELDAIILSLKVASIAVLFSLPFAIAIAWLLSRKDFYGKN
ILNGIIHLPLVLPPVVIGYLLLILMAKKGIIGQVLWQWFGFSFSFSWRGA
VLASMVMAFPLMVRSIRLTIDNIDPKLEQAARTLGASPLKVFWTITLPLS
WSGIIAGAVLGFARSLGEFGATITFVSNIPNQTQTIPAALFTFIEIPNNE
LAATRLCMVAIAISLFALFTSEWLAQKQKR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTATCTTCTATGTTTAATTTTACGCCACAAGAGCTTGATGCGATTAT
TTTAAGTCTGAAAGTCGCCTCAATAGCGGTGCTTTTTTCATTACCTTTTG
CTATTGCAATCGCATGGTTATTATCTAGGAAAGATTTTTATGGTAAGAAT
ATACTAAACGGCATTATTCATTTACCACTTGTGCTGCCACCTGTAGTCAT
CGGTTATTTATTACTTATTTTAATGGCTAAAAAAGGCATTATTGGGCAAG
TATTATGGCAATGGTTTGGTTTTTCATTCAGTTTTTCTTGGCGAGGGGCT
GTATTAGCTTCAATGGTGATGGCATTTCCATTAATGGTACGATCCATTCG
TTTAACGATTGATAATATCGATCCCAAATTAGAACAAGCGGCACGTACTT
TAGGCGCTAGTCCGTTGAAAGTGTTTTGGACTATTACGTTACCATTGTCA
TGGTCTGGCATTATCGCAGGTGCTGTTTTGGGGTTTGCTCGTTCATTAGG
CGAGTTTGGTGCAACAATTACTTTCGTATCCAATATTCCTAATCAAACAC
AAACCATTCCAGCCGCACTGTTTACTTTTATTGAAATACCAAATAATGAA
CTGGCGGCTACGCGTTTATGTATGGTGGCAATAGCCATTTCATTATTCGC
ATTATTTACATCCGAATGGCTGGCCCAAAAGCAAAAACGTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy