Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1344 IGR1343 IGR1340 IGR1341 IGR1346 IGR1345 IGR1339 IGR1342 pgsA, - HD1813 dsvC, - HD1815 apt, - HD1818 yccA, - HD1814 modB, - HD1824 modA, - HD1823 yadH, - HD1821 yfeA, - HD1816 yadG, - HD1820 modC, - HD1826 dnaX, - HD1819 pgsA, - HD1813 dsvC, - HD1815 apt, - HD1818 yccA, - HD1814 modB, - HD1824 modA, - HD1823 yadH, - HD1821 yfeA, - HD1816 yadG, - HD1820 modC, - HD1826 dnaX, - HD1819 pgsA, - HD1813 dsvC, - HD1815 apt, - HD1818 yccA, - HD1814 modB, - HD1824 modA, - HD1823 yadH, - HD1821 yfeA, - HD1816 yadG, - HD1820 modC, - HD1826 dnaX, - HD1819 HD1825 yfeB, - HD1817 yfeB, - HD1817 HD1825
* Calculated from Protein Sequence

Gene ID: HD1819

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
dnaX  

Definition:
DNA polymerase III, subunits gamma and tau (dnaX)

Gene Start:
1524360

Gene Stop:
1526423

Gene Length:
2064

Molecular Weight*:
77109

pI*:
6.10

Net Charge*:
-9.21

EC:
2.7.7.7  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Purine metabolism
Pyrimidine metabolism

Secondary Evidence:
Bullard JM, Pritchard AE, Song MS, Glover BP, Wieczorek A, Chen J, Janjic N, McHenry CS.
A three-domain structure for the delta subunit of the DNA polymerase III holoenzyme delta domain III binds delta' and assembles into the DnaX complex.
J Biol Chem. 2002 Apr 12;277(15):13246-56.
PMID: 11809766

Pritchard AE, McHenry CS.
Assembly of DNA polymerase III holoenzyme: co-assembly of gamma and tau is inhibited by DnaX complex accessory proteins but stimulated by DNA polymerase III core.
J Biol Chem. 2001 Sep 14;276(37):35217-22.
PMID: 11463784

Flower,A.M. and McHenry,C.S.
The adjacent dnaZ and dnaX genes of Escherichia coli are contained
within one continuous open reading frame
Nucleic Acids Res. 14 (20), 8091-8101 (1986)
Medline: 87040775

Blinkowa,A.L. and Walker,J.R.
Programmed ribosomal frameshifting generates the Escherichia coli
DNA polymerase III gamma subunit from within the tau subunit
reading frame
Nucleic Acids Res. 18 (7), 1725-1729 (1990)
Medline: 90245560



Comment:
For other "dna" genes, see HD1372 (dnaB), HD1771 (dnaJ), HD0973 (dnaB), HD0189 (dnaK), HD1935 (dnaX), HD0551 (dnaE), HD0690 (dnaG), HD0850 (dnaN), HD0851 (dnaA)

Blast Summary:  PSI-Blast Search
Significant hits to DNA polymerase III subunits with gapped BLAST; e.g. residues 1-684 are 48% similar to Dna polymerase III (U32802) of Haemophilus influenzae, residues 1-684 are 45% similar to Dna polymerase III gamma/tau chain (X04275) of E. coli, residues 1-684 are 44% similar to Dna polymerase III gamma/tau chain (U66040) of Salmonella typhimurium.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0470
COG name: ATPase involved in DNA replication
Functional Class: L
The phylogenetic pattern of COG0470 is AMTKYQVCEBRHUJGPOLINX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 24-64 are 82% similar to a (DNA POLYMERASE III GAMMA) protein domain (PD022234) which is seen in Q9CNR3_PASMU.

Residues 190-250 are 65% similar to a (SUBUNIT DNA REPLICATION POLYMERASE III FACTOR COMPLETE) protein domain (PD001148) which is seen in Q9CNR3_PASMU.

Residues 507-684 are 38% similar to a (DNA POLYMERASE III SUBUNIT) protein domain (PD018170) which is seen in DP3X_HAEIN.

Residues 72-141 are 94% similar to a (DNA POLYMERASE III SUBUNIT) protein domain (PD035127) which is seen in DP3X_HAEIN.

Residues 143-187 are 88% similar to a (DNA POLYMERASE III SUBUNIT) protein domain (PD191176) which is seen in DP3X_HAEIN.

Residues 271-353 are 59% similar to a (DNA POLYMERASE III SUBUNIT) protein domain (PD274257) which is seen in Q9CNR3_PASMU.

Residues 39-141 are 35% similar to a (DNA POLYMERASE III SUBUNIT) protein domain (PD345569) which is seen in Q9JV62_NEIMA.

Residues 17-156 are 61% similar to a (ATP-BINDING PROTEASE SUBUNIT PROTEOME COMPLETE) protein domain (PD000092) which is seen in Q9JTS1_NEIMA.

Residues 11-60 are 62% similar to a (SUBUNIT REPLICATION DNA FACTOR) protein domain (PD022232) which is seen in DP3X_BACSU.



Paralogs:  Local Blast Search
HD1819 is paralogously related to HD1935 (3e-14) and HD1296 (5e-10).


Pfam Summary:  Pfam Search
Residues 40 to 230 (E-value = 2.1e-06) place HD1819 in the AAA family which is described as ATPase family associated with various cellular activities (AAA) (PF00004)

PDB Hit:
pdb|1A5T| Crystal Structure Of The Delta Prime Subunit Of The... 77 5e-015

Gene Protein Sequence:
MSYQVLARKWRPQRFSEVIGQQHVLSALENGLRQDKLHHAYLFSGTRGVG
KTSIARLFAKGLNCETSITATPCGKCENCKAIEEGRFIDLIEIDAASRTK
VEDTRELLDNVQYKPTVGRFKVYLIDEVHMLSRHSFNALLKTLEEPPEYV
KFLLATTDPQKLPVTILSRCMQFHLRALTPTQLSQHLEFILTQENIPYEL
AAIEKLAKAAQGSIRDSLSLTDQAIAVSNTNITLPIVSEMLGLIDDDQPL
ELVMALAQANGDQVMAIIQNIATKGIDWQQLLNDVAETLHQIAMLQLLKQ
ETPSDTPLHLLAKQIPPEDVQFFYQLMLIGKKELAYAPEQSIGVEMVFLR
ALAFHPKRTEEINQRAQLNQANNEQSAMVDNTQHKLEQLKANLTQVTTDK
TSAQAVESSSKRSIKSAQQTVPANITDSTNNTLISPALVAMQARKQLQQK
HVELNQHEKKKRKSITVNSTSSPTEITTNTQHQSLDLQERLMNLAHSTAK
VTSQPSEPEVDSQSTEEDYCWTWLDPELAIENKSTKPAEIKQAILQDKTP
ELVAKTIELACEQDQWCQIINTLNLSSFSRQIALNSYLAQTTAQQLDLVL
KPSMSHLDNEESRKSLTLALADKGFTYKLVIGESAEHKTPLEIRRMIFEK
LTLAAKQALNNDEKLMLLRDTFAAEIDESTIRAVANI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCTACCAAGTTTTAGCACGTAAATGGCGTCCACAACGATTTTCAGA
AGTAATTGGGCAACAACACGTATTATCCGCATTAGAAAACGGTCTACGTC
AAGATAAATTACATCATGCTTACCTTTTTTCTGGTACACGAGGCGTTGGT
AAAACATCAATCGCCCGCTTGTTTGCTAAAGGACTCAATTGTGAAACAAG
CATTACCGCCACACCTTGTGGCAAATGTGAAAATTGCAAAGCAATTGAAG
AAGGTAGATTCATTGATTTAATTGAGATCGATGCGGCTTCTCGAACGAAA
GTAGAAGATACACGAGAATTATTAGATAATGTCCAATATAAGCCTACAGT
TGGGCGCTTTAAAGTTTATCTGATTGATGAAGTACATATGCTCTCACGGC
ATAGTTTTAATGCTTTACTCAAAACACTTGAAGAACCGCCCGAATATGTA
AAATTTTTGCTTGCGACCACCGATCCTCAAAAATTACCGGTGACTATTTT
ATCGCGTTGTATGCAATTTCATTTAAGAGCTTTAACACCAACGCAACTTA
GCCAGCATCTTGAGTTTATTCTCACGCAAGAAAACATTCCTTATGAATTA
GCCGCCATTGAAAAACTAGCAAAAGCAGCTCAAGGTAGTATTCGAGATTC
ATTAAGTTTGACAGACCAAGCGATTGCCGTAAGTAATACCAATATTACAT
TACCGATAGTTAGCGAAATGTTAGGCTTAATCGATGATGATCAACCGCTT
GAATTAGTGATGGCTCTAGCCCAAGCAAATGGCGATCAAGTTATGGCTAT
TATCCAAAACATTGCAACAAAAGGCATTGACTGGCAACAATTGCTAAATG
ATGTGGCAGAAACCTTACACCAAATTGCAATGTTGCAATTGCTTAAACAA
GAAACACCATCAGACACGCCATTACATTTGCTCGCAAAACAGATACCACC
TGAAGATGTGCAATTTTTTTATCAGTTAATGCTCATCGGCAAAAAAGAAT
TAGCTTATGCACCAGAACAAAGTATTGGTGTAGAAATGGTATTTTTACGT
GCCTTAGCATTTCATCCTAAACGTACTGAAGAAATTAACCAACGTGCGCA
ACTAAATCAAGCAAATAACGAACAGTCGGCAATGGTTGACAATACCCAAC
ATAAGCTTGAACAGCTCAAAGCAAATTTAACACAAGTAACAACAGATAAA
ACAAGTGCACAAGCGGTCGAATCTTCAAGCAAACGATCAATAAAGTCTGC
GCAACAAACTGTGCCGGCTAATATTACAGATAGCACAAATAATACGCTAA
TCTCACCCGCACTTGTTGCAATGCAAGCGCGGAAACAATTACAACAAAAG
CACGTTGAATTAAATCAACACGAAAAAAAAAAGCGTAAATCTATAACGGT
TAATTCAACAAGTTCGCCAACAGAGATAACGACCAACACACAACATCAAT
CGTTAGATTTACAAGAACGTTTGATGAATTTAGCTCATTCTACCGCTAAA
GTGACGAGTCAACCCTCTGAGCCGGAAGTCGACAGTCAATCAACCGAAGA
AGATTATTGTTGGACTTGGCTAGATCCAGAGTTAGCGATTGAGAACAAAA
GCACTAAACCTGCTGAAATTAAACAGGCTATTTTACAAGATAAAACGCCT
GAATTAGTTGCCAAAACCATTGAACTTGCTTGCGAACAAGATCAATGGTG
TCAGATTATTAATACCCTTAATCTCAGTAGCTTTTCACGTCAAATAGCAC
TTAATAGCTATCTTGCACAAACAACAGCCCAACAATTAGATTTAGTTTTA
AAACCGTCAATGTCACACTTAGACAATGAAGAATCACGAAAAAGTTTAAC
ACTCGCGTTAGCAGACAAAGGATTCACTTATAAATTAGTGATAGGCGAAA
GTGCCGAACACAAAACGCCACTAGAAATTCGCCGGATGATTTTTGAGAAA
TTAACTTTAGCGGCTAAGCAAGCATTGAATAATGATGAAAAATTAATGCT
ATTACGTGATACCTTTGCAGCTGAAATTGATGAATCAACTATTCGTGCTG
TCGCCAACATATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy