Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1344 IGR1343 IGR1340 IGR1341 IGR1346 IGR1345 IGR1338 IGR1339 IGR1342 pgsA, - HD1813 uvrC, - HD1812 dsvC, - HD1815 apt, - HD1818 yccA, - HD1814 modB, - HD1824 modA, - HD1823 yadH, - HD1821 yfeA, - HD1816 yadG, - HD1820 dnaX, - HD1819 pgsA, - HD1813 uvrC, - HD1812 dsvC, - HD1815 apt, - HD1818 yccA, - HD1814 modB, - HD1824 modA, - HD1823 yadH, - HD1821 yfeA, - HD1816 yadG, - HD1820 dnaX, - HD1819 pgsA, - HD1813 uvrC, - HD1812 dsvC, - HD1815 apt, - HD1818 yccA, - HD1814 modA, - HD1823 yadH, - HD1821 yfeA, - HD1816 yadG, - HD1820 dnaX, - HD1819 yfeB, - HD1817 yfeB, - HD1817 modB, - HD1824
* Calculated from Protein Sequence

Gene ID: HD1818

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
apt  

Definition:
adenine phosphoribosyltransferase (apt)

Gene Start:
1523793

Gene Stop:
1524332

Gene Length:
540

Molecular Weight*:
19300

pI*:
6.80

Net Charge*:
-0.28

EC:
2.4.2.7  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Salvage of nucleosides and nucleotides  

Pathway: pathway table
Purine metabolism

Secondary Evidence:
Hershey,H.V. and Taylor,M.W.
Nucleotide sequence and deduced amino acid sequence of Escherichia
coli adenine phosphoribosyltransferase and comparison with other
analogous enzymes
Gene 43 (3), 287-293 (1986)
Medline: 86301884


Comment:


Blast Summary:  PSI-Blast Search
Numerous hits to adenine phosphoribosyltransferases with gapped BLAST; e.g. residues 18-194 are 69% similar to adenine phosphoribosyltransferase (apt) (U32802) of Haemophilus influenzae, residues 18-194 are 61% similar to apt (U82664) of E. coli, residues 20-194 are 46% similar to adenine phosphoribosyltransferase (AF109172) of Rhizobium galegae.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0503
COG name: Adenine/guanine phosphoribosyltransferases
Functional Class: F
The phylogenetic pattern of COG0503 is -mtkY-vcEBrHujgpol---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002375 (Purine/pyrimidine phosphoribosyl transferase) with a combined E-value of 3e-07.
    IPB002375A    82-86
    IPB002375B    115-130


ProDom Summary:  Protein Domain Search
Residues 60-114 are 81% similar to a (TRANSFERASE ADENINE GLYCOSYLTRANSFERASE) protein domain (PD001933) which is seen in APT_HAEIN.

Residues 9-107 are 37% similar to a (GLYCOSYLTRANSFERASE ADENINE) protein domain (PD061276) which is seen in O77103_LEITA.

Residues 17-58 are 71% similar to a (TRANSFERASE ADENINE GLYCOSYLTRANSFERASE) protein domain (PD028734) which is seen in APT_HAEIN.

Residues 126-173 are 62% similar to a (TRANSFERASE ADENINE GLYCOSYLTRANSFERASE) protein domain (PD267958) which is seen in Q9KT52_VIBCH.



Paralogs:  Local Blast Search
HD1818 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 26 to 162 (E-value = 5.7e-46) place HD1818 in the Pribosyltran family which is described as Phosphoribosyl transferase domain (PF00156)

PDB Hit:
pdb|1QB7|A Chain A, Crystal Structures Of Adenine Phosphoribosy... 66 2e-012
pdb|1QB7|A Chain A, Crystal Structures Of Adenine Phosphoribosy... 223 9e-060

Gene Protein Sequence:
MNQLDLIKSSIKSIPNYPKVGIIFRDITSLLENPTAFKASIDAIVAEFKN
KGITKVVGTESRGFIFGAPVALALGLPFVLVRKPHKLPRAVISQSYALEY
GEDTLEMHLDSINQDDNVLVVDDLLATGGTIDATAKLIRQLGGQVKNAAF
VIGLPDLGGKARLEQIGIKSFTLVEFDGH$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATCAGCTAGATTTAATTAAATCATCTATCAAATCTATTCCTAATTA
CCCCAAAGTTGGCATCATTTTCCGTGATATTACTTCTTTACTAGAAAATC
CTACCGCATTTAAAGCATCTATAGATGCAATCGTCGCAGAATTCAAAAAT
AAAGGCATCACTAAAGTCGTCGGCACAGAATCTCGTGGTTTTATCTTTGG
AGCGCCTGTAGCCCTAGCATTAGGGCTACCCTTTGTATTAGTGCGTAAAC
CTCATAAATTACCAAGAGCCGTTATTTCGCAATCCTATGCCCTTGAATAT
GGTGAAGATACACTTGAAATGCACCTAGATTCTATCAATCAAGATGACAA
CGTATTAGTGGTAGATGATCTATTAGCTACTGGTGGCACTATTGATGCGA
CCGCCAAATTAATTCGCCAATTAGGCGGTCAAGTTAAAAATGCGGCTTTT
GTTATTGGGTTACCCGATTTAGGCGGTAAAGCACGACTTGAACAAATCGG
CATCAAATCATTCACACTAGTGGAATTTGACGGCCATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy