Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1344 IGR1343 IGR1340 IGR1341 IGR1345 IGR1338 IGR1339 IGR1342 pgsA, - HD1813 uvrC, - HD1812 dsvC, - HD1815 apt, - HD1818 yccA, - HD1814 modA, - HD1823 yadH, - HD1821 yfeA, - HD1816 yadG, - HD1820 dnaX, - HD1819 pgsA, - HD1813 uvrC, - HD1812 dsvC, - HD1815 apt, - HD1818 yccA, - HD1814 modA, - HD1823 yadH, - HD1821 yfeA, - HD1816 yadG, - HD1820 dnaX, - HD1819 pgsA, - HD1813 uvrC, - HD1812 dsvC, - HD1815 apt, - HD1818 yccA, - HD1814 yadH, - HD1821 yfeA, - HD1816 yadG, - HD1820 dnaX, - HD1819 yfeB, - HD1817 yfeB, - HD1817 modA, - HD1823
* Calculated from Protein Sequence

Gene ID: HD1817

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
yfeB  

Definition:
iron (chelated) ABC transporter, ATP-binding protein

Gene Start:
1522829

Gene Stop:
1523587

Gene Length:
759

Molecular Weight*:
27832

pI*:
9.20

Net Charge*:
4.82

EC:
 

Functional Class:
Transport and binding proteins; ABC Superfamily: ATP-binding protein  

Pathway: pathway table

Secondary Evidence:
Bearden SW, Staggs TM, Perry RD.
An ABC transporter system of Yersinia pestis allows utilization of chelated iron by Escherichia coli SAB11.
J Bacteriol 1998 Mar;180(5):1135-47.
Medline: 98155139

Comment:
For other components see HD1814 (MSD1) and HD1816 (SBP1).


This protein is part of an ATP-driven transport system.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to probable iron transport system and to ATP-binding ABC transport protein sequences,e.g.residues 8-250 are 74% similar to a probable iron transport system in Haemophilus influenzae Rd KW20 (1169664|).

COGS Summary:  COGS Search
BeTs to 10 clades of COG1121
COG name: ABC-type iron (III) transport system, ATPase component
Functional Class: P
The phylogenetic pattern of COG1121 is a-tk-qvCeB-H-----LINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB001140 (ABC transporter transmembrane region) with a combined E-value of 2e-28.
    IPB001140A    26-72
    IPB001140B    144-182
    IPB001140C    198-227


ProDom Summary:  Protein Domain Search
Residues 192-242 are 70% similar to a (ATP-BINDING TRANSPORTER COMPLETE PROTEOME) protein domain (PD000174) which is seen in Q9CNM8_PASMU.

Residues 84-144 are 85% similar to a (ATP-BINDING TRANSPORT IRON ABC) protein domain (PD330862) which is seen in Y361_HAEIN.

Residues 83-142 are 60% similar to a (ATP-BINDING TRANSPORT PROTEOME COMPLETE) protein domain (PD001985) which is seen in MNTA_SYNY3.

Residues 85-145 are 39% similar to a (ATP-BINDING TRANSPORT METAL SYSTEM) protein domain (PD261867) which is seen in Y339_CHLMU.

Residues 27-75 are 61% similar to a (ATP-BINDING TRANSPORT ABC TRANSPORTER COMPLETE PROTEOME) protein domain (PD000005) which is seen in Y361_HAEIN.

Residues 146-189 are 93% similar to a (ATP-BINDING TRANSPORT ABC TRANSPORTER COMPLETE PROTEOME) protein domain (PD000006) which is seen in Q9CNM8_PASMU.



Paralogs:  Local Blast Search
HD1817 is paralogously related to HD1338 (9e-28), HD0586 (2e-23), HD1098 (5e-23), HD0860 (2e-21), HD1820 (2e-20), HD1672 (1e-18), HD2032 (1e-17), HD1826 (4e-17), HD0259 (6e-17), HD0982 (1e-16), HD0811 (2e-16), HD1651 (3e-16), HD1671 (5e-16), HD0231 (6e-16), HD0224 (8e-16), HD1630 (3e-15), HD1652 (3e-14), HD1019 (5e-14), HD0316 (1e-13), HD0572 (4e-13), HD1745 (3e-12), HD0315 (1e-11), HD0863 (1e-11), HD0786 (3e-11), HD1768 (7e-11), HD1235 (2e-07) and HD1286 (7e-07).


Pfam Summary:  Pfam Search
Residues 37 to 222 (E-value = 1e-44) place HD1817 in the ABC_tran family which is described as ABC transporter (PF00005)

PDB Hit:
pdb|1B0U|A Chain A, Atp-Binding Subunit Of The Histidine Permea... 82 5e-017
pdb|1G29|1 Chain 1, Malk >gi|12084695|pdb|1G29|2 Chain 2, Malk 81 1e-016

Gene Protein Sequence:
MNNITQATASISVDKLTVRYNNGHLALENVSFQLQHGTVCALIGVNGGGK
STLFKSLMGLVKPLTGQVLLNQMPIQKALKQNLVSYVPQSEEVDWQFPVS
VYDVVMMGRYGYMNFLRNPSALDKQKVEQAMQRVDISHLQHRQIGELSGG
QKKRVFLARALAQESQIILLDEPFTGVDVKTENAIVALLQQLRSEGHLVL
VSTHNLNSVSSFCDQVLMINRTLLASGPTATTFNHQNLEKVFGGIVHYLQ
AS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACAATATAACACAAGCTACAGCATCCATTTCTGTTGATAAATTAAC
CGTCCGTTACAACAACGGACATTTAGCCTTAGAAAATGTCTCTTTCCAGC
TTCAGCATGGCACTGTTTGTGCATTAATTGGCGTAAATGGCGGTGGTAAA
TCAACGCTTTTTAAAAGCTTGATGGGATTAGTTAAGCCGTTAACCGGTCA
AGTATTACTGAACCAAATGCCCATTCAAAAAGCACTTAAACAAAACCTTG
TTTCTTATGTGCCTCAAAGTGAAGAAGTGGATTGGCAATTCCCCGTATCT
GTTTATGACGTTGTGATGATGGGCCGTTATGGTTATATGAATTTTTTACG
CAATCCATCTGCACTAGATAAACAGAAAGTTGAACAAGCTATGCAACGTG
TTGATATTAGCCATTTGCAACATCGGCAAATTGGTGAACTCTCAGGCGGA
CAGAAAAAGCGGGTATTTCTGGCCCGAGCCTTAGCGCAAGAAAGCCAGAT
TATTTTATTAGATGAACCATTTACTGGTGTTGATGTCAAAACAGAAAATG
CCATTGTAGCTTTACTTCAACAATTGCGGAGTGAAGGGCATTTAGTATTG
GTTTCTACTCATAATCTCAACAGTGTATCTAGTTTTTGCGATCAAGTATT
AATGATTAATCGTACATTGCTTGCTTCGGGCCCAACGGCAACAACATTTA
ATCATCAAAATTTAGAGAAAGTATTTGGTGGCATTGTACATTATTTGCAA
GCTAGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy