Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1343 IGR1340 IGR1341 IGR1337 IGR1338 IGR1336 IGR1339 IGR1342 pgsA, - HD1813 uraA, - HD1811 uvrC, - HD1812 dsvC, - HD1815 apt, - HD1818 yccA, - HD1814 yfeA, - HD1816 yadG, - HD1820 dnaX, - HD1819 pgsA, - HD1813 uraA, - HD1811 uvrC, - HD1812 dsvC, - HD1815 apt, - HD1818 yccA, - HD1814 yfeA, - HD1816 yadG, - HD1820 dnaX, - HD1819 pgsA, - HD1813 uraA, - HD1811 uvrC, - HD1812 dsvC, - HD1815 apt, - HD1818 yccA, - HD1814 yfeA, - HD1816 yadG, - HD1820 dnaX, - HD1819 yfeB, - HD1817 yfeB, - HD1817
* Calculated from Protein Sequence

Gene ID: HD1815

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
dsvC  

Definition:
desulfoviridin gamma subunit/sulfite reductase

Gene Start:
1521521

Gene Stop:
1521856

Gene Length:
336

Molecular Weight*:
12814

pI*:
8.10

Net Charge*:
1.38

EC:
1.8.-.-  

Functional Class:
Central intermediary metabolism; Sulfur metabolism  

Pathway: pathway table
Folate biosynthesis

Secondary Evidence:
Karkhoff-Schweizer RR, Bruschi M, Voordouw G.
Expression of the gamma-subunit gene of desulfoviridin-type dissimilatory sulfite reductase and of the alpha- and beta-subunit genes is not coordinately regulated.
Eur J Biochem. 1993 Feb 1;211(3):501-7.
PMID: 8436111

Comment:


Blast Summary:  PSI-Blast Search
A few significant hits to hypothetical proteins / putative sulfite reductases with gapped BLAST; e.g. residues 3-11 are 66% similar to putative sulfite reductase/desulfoviridin gamma subunit (U32817) of Haemophilus influenzae, residues 3-11 are 66% similar to probable sulfite reductase (AE000199) of E. coli, residues 1-11 are 42% similar to sulfite reductase (AE000951) of Archaeoglobus fulgidus.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 9-111 are 70% similar to a (GAMMA SUBUNIT REDUCTASE COMPLETE) protein domain (PD012617) which is seen in Q9CNM6_PASMU.



Paralogs:  Local Blast Search

HD1815 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 3 to 111 (E-value = 4.1e-67) place HD1815 in the DsrC family which is described as DsrC like protein (PF04358)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MHMIECNGKQYLTDPTGYLLNLNDWSTELAIAIASKEQINLTEEHWEIIW
LVRDFYQEYKTSPAIRMLVKAMTLKFGEEKGNSRYLQRLFPEGPAKQATK
IAGLPKPIKCL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCATATGATCGAATGTAATGGCAAACAATATTTGACTGATCCCACAGG
CTATTTACTTAATTTAAATGACTGGTCTACTGAGTTAGCAATAGCAATAG
CAAGTAAAGAACAAATAAATTTAACTGAAGAACATTGGGAAATTATTTGG
TTAGTACGGGATTTCTATCAAGAATATAAGACATCTCCCGCGATTAGAAT
GTTAGTTAAAGCAATGACGCTCAAATTTGGTGAAGAAAAAGGCAATAGCC
GTTATTTACAACGTTTATTTCCGGAAGGTCCCGCCAAGCAAGCGACTAAA
ATTGCTGGCTTGCCTAAACCTATAAAATGTTTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy