Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1343 IGR1340 IGR1341 IGR1337 IGR1338 IGR1336 IGR1339 IGR1335 IGR1342 trxM,trxA, - HD1810 pgsA, - HD1813 hflK, - HD1809 uraA, - HD1811 uvrC, - HD1812 dsvC, - HD1815 apt, - HD1818 yccA, - HD1814 yfeA, - HD1816 dnaX, - HD1819 trxM,trxA, - HD1810 pgsA, - HD1813 hflK, - HD1809 uraA, - HD1811 uvrC, - HD1812 dsvC, - HD1815 apt, - HD1818 yccA, - HD1814 yfeA, - HD1816 dnaX, - HD1819 pgsA, - HD1813 hflK, - HD1809 uraA, - HD1811 uvrC, - HD1812 trxM,trxA, - HD1810 dsvC, - HD1815 apt, - HD1818 yccA, - HD1814 yfeA, - HD1816 dnaX, - HD1819 yfeB, - HD1817 yfeB, - HD1817
* Calculated from Protein Sequence

Gene ID: HD1814

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
yccA  

Definition:
carrier-transport protein

Gene Start:
1520794

Gene Stop:
1521459

Gene Length:
666

Molecular Weight*:
23750

pI*:
8.10

Net Charge*:
1.60

EC:
 

Functional Class:
Transport and binding proteins; ABC Superfamily: membrane spanning permease  

Pathway: pathway table

Comment:
For other components see HD1817 (NBD1) and HD1816 (SBP1).

Blast Summary:  PSI-Blast Search
Significant hits to conserved hypothetical protein with gapped BLAST; e.g. residues 1-221 are 58% similar to conserved hypothetical protein (U32689) of Haemophilus influenzae, residues 3-220 are 58% similar to hypothetical protein (X00547) of E. colik residues 21-221 are 55% similar to hypothetical protein (D13407) of Pseudomonas aeruginosa, residues 1-221 are 31% similar to conserved/putative integral membrane protein (AL162753) of Neisseria meningitidis.

COGS Summary:  COGS Search
BeTs to 7 clades of COG0670
COG name: Integral membrane protein YccA, interacts with FtsH
Functional Class: R
The phylogenetic pattern of COG0670 is ----y--cEb-huj--o-inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002199 (Uncharacterized protein family UPF0005) with a combined E-value of 2.8e-37.
    IPB002199A    17-39
    IPB002199B    104-140
    IPB002199C    167-210


ProDom Summary:  Protein Domain Search
Residues 82-220 are 69% similar to a (TRANSMEMBRANE INHIBITOR-1 BAX APOPTOSIS) protein domain (PD241206) which is seen in YCCA_ECOLI.

Residues 84-221 are 43% similar to a (PROTEOME COMPLETE TRANSPORT PERMEASE) protein domain (PD035975) which is seen in Q9KSA1_VIBCH.



Paralogs:  Local Blast Search
HD1814 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 14 to 218 (E-value = 1.2e-40) place HD1814 in the UPF0005 family which is described as Uncharacterised protein family UPF0005 (PF01027)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MENRLIANTAHNQSLLSTHKVLRNTYLLLSMTLAFSAIVAYFAMAMNAPA
LPWWGLLIGFYGLLFLTNTNANSAIGLACVFALTGFLGYTLGPILNRYVG
AGLGDAVMLALASTALVFFSCSAYILTTKKDMSFLSGMMMALFIVLLVGV
IANIFLAIPALSLAMSVLFALFSTGAILLTTSNIIHGGETNYIRATVDLY
VSLYNLFLSLLQIFGVLSKDD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAAATCGTTTAATTGCTAACACAGCTCATAATCAGTCTCTGCTTAG
CACGCATAAAGTCTTACGCAATACTTATCTATTACTCTCCATGACACTGG
CTTTTTCAGCGATTGTCGCTTACTTTGCAATGGCAATGAATGCACCCGCA
TTACCTTGGTGGGGCTTATTAATTGGTTTTTATGGCTTATTATTCTTAAC
GAATACTAATGCTAATAGTGCCATAGGGCTTGCCTGTGTCTTTGCCTTAA
CTGGTTTCTTAGGTTACACATTAGGCCCTATTTTGAACCGCTATGTAGGC
GCAGGCTTAGGGGATGCAGTTATGTTAGCATTAGCTTCAACTGCCTTAGT
CTTTTTTAGTTGTTCTGCTTATATCTTAACCACCAAAAAAGATATGTCCT
TTTTATCTGGTATGATGATGGCATTATTCATCGTGCTATTAGTTGGCGTT
ATTGCAAATATTTTCTTAGCCATACCGGCGCTAAGCCTAGCAATGAGTGT
TTTATTTGCGCTATTTTCAACCGGTGCTATTCTATTAACCACCAGCAACA
TTATTCACGGCGGTGAAACAAATTATATTCGCGCAACTGTAGATTTATAT
GTTTCACTTTACAACTTATTCTTAAGCTTATTACAAATTTTTGGTGTATT
AAGCAAGGACGATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy