Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1343 IGR1340 IGR1341 IGR1337 IGR1338 IGR1336 IGR1339 IGR1335 IGR1342 trxM,trxA, - HD1810 pgsA, - HD1813 hflK, - HD1809 uraA, - HD1811 uvrC, - HD1812 dsvC, - HD1815 apt, - HD1818 yccA, - HD1814 yfeA, - HD1816 dnaX, - HD1819 trxM,trxA, - HD1810 pgsA, - HD1813 hflK, - HD1809 uraA, - HD1811 uvrC, - HD1812 dsvC, - HD1815 apt, - HD1818 yccA, - HD1814 yfeA, - HD1816 dnaX, - HD1819 trxM,trxA, - HD1810 pgsA, - HD1813 hflK, - HD1809 uraA, - HD1811 uvrC, - HD1812 dsvC, - HD1815 apt, - HD1818 yccA, - HD1814 yfeA, - HD1816 dnaX, - HD1819 yfeB, - HD1817 yfeB, - HD1817
* Calculated from Protein Sequence

Gene ID: HD1813

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
pgsA  

Definition:
phosphatidylglycerophosphate synthase

Gene Start:
1520611

Gene Stop:
1520057

Gene Length:
555

Molecular Weight*:
21068

pI*:
9.70

Net Charge*:
4.13

EC:
2.7.8.5  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Glycerolipid metabolism

Secondary Evidence:
Gopalakrishnan AS, Chen YC, Temkin M, Dowhan W.
Structure and expression of the gene locus encoding the phosphatidylglycerophosphate synthase of Escherichia coli.
J Biol Chem 1986 Jan 25;261(3):1329-38.
Medline: 86111778.

Usui M, Sembongi H, Matsuzaki H, Matsumoto K, Shibuya I.
Primary structures of the wild-type and mutant alleles encoding the phosphatidylglycerophosphate synthase of Escherichia coli.
J Bacteriol 1994 Jun;176(11):3389-92.
Medline: 94253011.

Comment:
0

Blast Summary:  PSI-Blast Search
Numerous hits to phosphatidylglycerophosphate synthases (pgsA) with gapped BLAST; e.g. residues 2-182 are 67% similar to pgsA (U32698) of Haemophilus influenzae, residues 2-182 are 59% similar to phosphatidylglycerophosphate synthase (M12299) of E. coli, residues 2-181 are 47% similar to phosphatidylglycerophosphate synthase (AL162757) of Neisseria meningitidis.

COGS Summary:  COGS Search
BeTs to 15 clades of COG0558
COG name: Phosphatidylglycerophosphate synthase
Functional Class:  I
The phylogenetic pattern of COG0558 is A-tKYQvcEbRhujgpOLINx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000462 (CDP-alcohol phosphatidyltransferase) with a combined E-value of 4.4e-22.
    IPB000462    48-84


ProDom Summary:  Protein Domain Search
Residues 39-172 are 73% similar to a (TRANSFERASE COMPLETE PROTEOME SYNTHASE) protein domain (PD001399) which is seen in Q9CMH0_PASMU.

Residues 123-182 are 68% similar to a (SYNTHASE PHOSPHATIDYLGLYCEROPHOSPHATE) protein domain (PD085726) which is seen in PGSA_HAEIN.



Paralogs:  Local Blast Search

HD1813 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 38 to 176 (E-value = 6.7e-47) place HD1813 in the CDP-OH_P_transf family which is described as CDP-alcohol phosphatidyltransferase (PF01066)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MMKLNFPTYLTLFRVVLIPLFIAAFYLPEGWYAPEISTLIFFIASITDAF
DGYLARKWNQTTRLGAFLDPVADKILVTVAFVCIVEYYHSWWITIPVSIM
IAREILISALREWMAEIGERASVAVSIWGKVKTACQMLALGGMLWRQSTF
MEILAFILLYISAILTIWSMLQYLKASKKSLMKS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGAAACTAAATTTCCCGACTTATCTTACTTTATTCAGAGTTGTGTT
AATCCCATTATTTATTGCAGCATTTTATTTGCCTGAGGGATGGTATGCAC
CTGAAATTTCAACTTTAATTTTTTTCATTGCATCTATTACAGACGCATTT
GATGGCTATTTAGCGCGTAAATGGAATCAAACAACCCGTTTAGGCGCATT
TCTTGATCCTGTGGCAGATAAAATTTTGGTTACAGTAGCATTTGTCTGTA
TTGTGGAGTATTACCATAGTTGGTGGATTACTATTCCTGTTAGCATTATG
ATTGCCCGCGAAATTTTGATTTCTGCTTTACGAGAATGGATGGCTGAAAT
TGGCGAACGCGCGAGTGTTGCGGTGTCAATTTGGGGTAAAGTAAAAACCG
CCTGTCAAATGTTAGCGCTAGGCGGAATGTTATGGCGACAAAGTACTTTT
ATGGAAATCCTTGCCTTTATTTTGCTCTACATATCGGCGATTTTAACGAT
TTGGTCGATGTTACAATATTTAAAAGCTTCTAAGAAGAGTTTGATGAAAT
CTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy