Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1334 IGR1331 IGR1337 IGR1338 IGR1336 IGR1332 IGR1333 IGR1335 trxM,trxA, - HD1810 pgsA, - HD1813 HD1805 hflC, - HD1808 hflK, - HD1809 uraA, - HD1811 purA, - HD1807 thiI, - HD1806 uvrC, - HD1812 trxM,trxA, - HD1810 pgsA, - HD1813 HD1805 hflC, - HD1808 hflK, - HD1809 uraA, - HD1811 purA, - HD1807 thiI, - HD1806 uvrC, - HD1812 trxM,trxA, - HD1810 pgsA, - HD1813 HD1805 hflC, - HD1808 hflK, - HD1809 uraA, - HD1811 purA, - HD1807 thiI, - HD1806 uvrC, - HD1812
* Calculated from Protein Sequence

Gene ID: HD1809

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
hflK  

Definition:
hflK protein (hflK)

Gene Start:
1516147

Gene Stop:
1514942

Gene Length:
1206

Molecular Weight*:
45319

pI*:
8.80

Net Charge*:
2.00

EC:
3.4.-.-  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table
Biotin metabolism
Lysine degradation

Secondary Evidence:
Noble,J.A., Innis,M.A., Koonin,E.V., Rudd,K.E., Banuett,F. and
Herskowitz,I.
The Escherichia coli hflA locus encodes a putative GTP-binding
protein and two membrane proteins, one of which contains a
protease-like domain
Proc. Natl. Acad. Sci. U.S.A. 90 (22), 10866-10870 (1993)
Medline: 94068503

Banuett,F. and Herskowitz,I.
Identification of polypeptides encoded by an Escherichia coli locus (hflA) that governs the lysis-lysogeny decision of bacteriophage lambda
J. Bacteriol. 169 (9), 4076-4085 (1987)
Medline: 87307985



Comment:


Blast Summary:  PSI-Blast Search
Signficant hits to HflK protein with gapped BLAST; e.g. residues 4-401 are 59% similar to hflK protein (U32701) of Haemophilus influenzae, residues 1-355 are 52% similar to HflK protein (U000005) of E. coli, residues 1-401 are 45% similar to HflK protein (U09005) of Vibrio parahaemolyticus.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0330
COG name: Membrane protease subunits, stomatin/prohibitin homologs
Functional Class: O
The phylogenetic pattern of COG0330 is amTKYqVCEbrHuj--OL--X
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB001972 (Band 7 protein family/Stomatin) with a combined E-value of 1.2e-44.
    IPB001972A    93-109
    IPB001972B    131-161
    IPB001972C    169-218
    IPB001972D    222-267
    IPB001972E    289-304


ProDom Summary:  Protein Domain Search
Residues 96-193 are 68% similar to a (GNA1220 MEMBRANE PROTEOME COMPLETE) protein domain (PD413090) which is seen in HFLK_ECOLI.

Residues 6-51 are 50% similar to a (HFLK PROTEOME COMPLETE TRANSMEMBRANE) protein domain (PD107531) which is seen in Q9CPD0_PASMU.

Residues 240-340 are 74% similar to a (PROTEOME COMPLETE TRANSMEMBRANE PROTEASE) protein domain (PD016942) which is seen in Q9CPD0_PASMU.

Residues 82-239 are 79% similar to a (PROTEOME COMPLETE TRANSMEMBRANE PROTEASE) protein domain (PD300956) which is seen in Q9CPD0_PASMU.



Paralogs:  Local Blast Search
HD1809 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 93 to 268 (E-value = 2.6e-52) place HD1809 in the Band_7 family which is described as SPFH domain / Band 7 family (PF01145)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MSWNESGNQQDPWGKPGQKKPEQQEPSGQGNQQDPNRPKSAQNPPDLEEA
FGKLLKKMGGGNKHSNNQRPASLGKFIPAIVIFSALVWGASGFYTVQEAE
RGVVTRFGKLHQIVMPGLNWKPTFIDQVIPINIERVSELKTQGSMLTQDE
NMVQVEMTVQYRVEDPAKYKFSVRNADDSLKQATDSALRYVIGHMSMDDI
LTKGRATVREKTWETLREIIKTYDMGLLVTDVNFQSARPPEEVKDAFDDA
IKAQEDEQRLIREAEAYARGREPLARGQAQRIIEQATAYKEQIVLEAQGD
IQRFSKLLPEYQAAPAVMRERLYIETMEKVMKNTPKIIMDSNSNNVNVLP
LEKFLGKTTASEVAQKPLATPVQQPQVSHQLAPSVVTEDRNREQPIRRGR
F$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCGTGGAATGAATCAGGCAATCAGCAAGACCCTTGGGGTAAACCAGG
TCAAAAAAAGCCTGAACAGCAAGAACCATCAGGTCAAGGTAATCAGCAAG
ATCCTAATCGCCCCAAATCAGCACAAAATCCACCTGATTTAGAGGAAGCA
TTTGGTAAGTTATTGAAAAAAATGGGCGGTGGTAATAAACACTCAAATAA
TCAACGACCAGCTTCTTTGGGTAAATTTATTCCTGCTATTGTGATTTTTA
GTGCATTAGTATGGGGAGCCTCAGGTTTTTATACTGTGCAAGAGGCAGAA
CGAGGTGTAGTAACCCGTTTTGGTAAGTTACATCAAATTGTGATGCCAGG
TTTAAATTGGAAACCAACTTTTATTGATCAAGTCATTCCTATAAATATTG
AACGCGTATCTGAATTAAAAACACAAGGTTCAATGTTGACTCAAGATGAA
AATATGGTGCAAGTCGAAATGACCGTGCAATATCGCGTTGAAGATCCCGC
TAAATATAAATTTAGTGTGCGTAATGCCGATGATAGTTTAAAACAAGCAA
CAGATAGTGCATTACGTTATGTGATTGGCCATATGTCAATGGATGATATA
TTGACTAAAGGACGAGCAACTGTCCGTGAAAAAACGTGGGAAACATTGCG
TGAAATTATTAAGACCTACGATATGGGATTGCTAGTAACTGACGTAAACT
TCCAATCAGCACGCCCACCGGAAGAAGTTAAAGATGCTTTCGATGATGCT
ATTAAGGCACAAGAAGATGAACAACGTTTAATCCGTGAAGCAGAAGCGTA
TGCACGAGGTCGTGAACCTCTTGCTCGTGGTCAAGCACAACGTATTATTG
AACAAGCCACAGCCTATAAAGAACAAATTGTGCTTGAAGCACAAGGCGAT
ATTCAACGTTTTTCTAAACTTTTACCTGAGTATCAGGCAGCGCCTGCGGT
CATGCGTGAGCGTTTATATATTGAAACAATGGAAAAAGTAATGAAAAACA
CACCTAAAATTATTATGGATAGCAACAGTAATAATGTGAATGTATTACCG
CTTGAAAAATTTTTAGGGAAAACGACGGCTTCTGAAGTAGCACAAAAACC
ATTAGCTACTCCGGTACAACAACCACAAGTTAGTCACCAACTAGCGCCAA
GTGTAGTAACAGAAGACAGAAATAGGGAACAACCAATTCGTAGAGGGAGA
TTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy