Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1334 IGR1330 IGR1331 IGR1337 IGR1336 IGR1332 IGR1333 IGR1335 IGR1329 trxM,trxA, - HD1810 HD1805 hflC, - HD1808 hflK, - HD1809 uraA, - HD1811 purA, - HD1807 thiI, - HD1806 uvrC, - HD1812 thrS, - HD1803 HD1804 trxM,trxA, - HD1810 HD1805 hflC, - HD1808 hflK, - HD1809 uraA, - HD1811 purA, - HD1807 thiI, - HD1806 uvrC, - HD1812 thrS, - HD1803 HD1804 trxM,trxA, - HD1810 HD1805 hflC, - HD1808 hflK, - HD1809 uraA, - HD1811 purA, - HD1807 thiI, - HD1806 uvrC, - HD1812 thrS, - HD1803 HD1804
* Calculated from Protein Sequence

Gene ID: HD1807

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
purA  

Definition:
adenylosuccinate synthetase

Gene Start:
1513916

Gene Stop:
1512618

Gene Length:
1299

Molecular Weight*:
47248

pI*:
5.60

Net Charge*:
-6.61

EC:
6.3.4.4  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
Alanine and aspartate metabolism
Purine metabolism

Secondary Evidence:
Jayalakshmi R, Sumathy K, Balaram H.
Purification and characterization of recombinant Plasmodium falciparum adenylosuccinate synthetase expressed in Escherichia coli.
Protein Expr Purif. 2002 Jun;25(1):65-72.
PMID: 12071700

Hoffman JA, Badger JL, Zhang Y, Kim KS.
Escherichia coli K1 purA and sorC are preferentially expressed upon association with human brain microvascular endothelial cells.
Microb Pathog. 2001 Aug;31(2):69-79.
PMID: 11453702

Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits to adenylosuccinate synthetases (purA) with gapped BLAST; e.g. residues 1-432 are 82% similar to purA of Haemophilus influenzae, residues 1-432 are 72% similar to purA (U14003) of E. coli, residues 1-430 are 58% similar to purA (AE002435) of Neisseria meningitidis.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0104
COG name: Adenylosuccinate synthase
Functional Class:  F
The phylogenetic pattern of COG0104 is amtkyqvcebrhuj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001114 (Adenylosuccinate synthetase) with a combined E-value of 2.6e-170.
    IPB001114A    18-55
    IPB001114B    97-117
    IPB001114C    127-152
    IPB001114D    219-257
    IPB001114E    263-282
    IPB001114F    295-336
    IPB001114G    373-405


ProDom Summary:  Protein Domain Search
Residues 396-432 are 83% similar to a (LIGASE ADENYLOSUCCINATE AMPSASE ADSS) protein domain (PD003550) which is seen in PURA_ECOLI.

Residues 7-144 are 43% similar to a (LIGASE AMPSASE ADSS GTP-BINDING) protein domain (PD176155) which is seen in PURA_METJA.

Residues 399-430 are 78% similar to a (LIGASE PROTEOME COMPLETE ADENYLOSUCCINATE) protein domain (PD329917) which is seen in Q9HUM6_PSEAE.



Paralogs:  Local Blast Search

HD1807 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
pdb|1ADE|A Chain A, Structure Of Adenylosuccinate Synthetase Ph... 645 0.0
pdb|1CG1|A Chain A, Structure Of The Mutant (K16q) Of Adenylosu... 643 0.0
pdb|1CG4|A Chain A, Structure Of The Mutant (R303l) Of Adenylos... 642 0.0

Gene Protein Sequence:
MGKSVAILGAQWGDEGKGKIVDLLTDRVKYVVRYQGGHNAGHTLIINGEK
TVLRLIPSGILRENVTCLIGNGVVLSPEALMKEMGELEACGINVRERLKI
SEACPLILPYHVAMDHAREAALGKNKIGTTGRGIGPAYEDKVARRGLRVS
DLFDKEAFATKLKDILDLYNFQLVHYYKVEPVDFQKTLDDVFAVADVIKG
MVADVTTLLHQARKEGVNILFEGAQGTMLDIDHGTYPFVTSSNTTAGGVA
TGAGFGPRNLDYVLGIIKAYCTRVGSGPFTTELFNEEGETIARKGNEFGA
VTGRPRRCGWFDAVAVRRAVQINSISGFCMTKLDVLDGFETLKICTAYKM
PNGEIVEYAPMAAKDWEGVEPIYETMPGWSENTFGVIKYEALPQAALDYI
KRIEELVGVPVDILSTGPDRIETMILRDPFVA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGTAAAAGTGTTGCTATTCTCGGTGCTCAATGGGGCGATGAAGGGAA
GGGTAAAATTGTAGATTTATTAACTGACCGAGTGAAATATGTGGTTCGTT
ATCAAGGTGGGCATAATGCTGGCCATACATTAATTATTAATGGAGAGAAA
ACGGTTCTACGTTTAATCCCTAGTGGTATTTTACGTGAAAATGTTACGTG
TTTAATTGGTAACGGAGTTGTACTTTCCCCTGAAGCATTGATGAAAGAAA
TGGGTGAGTTGGAAGCATGTGGTATTAATGTTCGTGAGCGGTTAAAAATT
TCAGAAGCGTGTCCTCTCATTCTTCCTTATCATGTAGCGATGGATCATGC
ACGTGAAGCTGCATTAGGCAAAAATAAAATTGGTACTACCGGGCGTGGTA
TTGGCCCTGCTTATGAAGATAAAGTGGCTCGCCGTGGTTTACGTGTCAGC
GATCTATTTGATAAAGAAGCATTTGCCACAAAACTTAAAGATATTTTAGA
TCTATATAATTTCCAATTAGTTCATTATTACAAAGTTGAGCCGGTAGATT
TCCAAAAAACATTAGATGACGTTTTTGCTGTTGCTGATGTGATTAAAGGA
ATGGTGGCGGATGTAACCACTTTACTTCATCAAGCACGTAAAGAAGGTGT
AAATATTTTATTTGAAGGTGCGCAAGGTACGATGTTGGATATTGATCACG
GCACTTATCCGTTTGTAACCAGTTCAAATACCACTGCAGGAGGCGTTGCA
ACAGGGGCAGGTTTTGGACCGCGTAATCTTGATTATGTATTAGGCATTAT
TAAAGCGTATTGTACACGTGTTGGTAGCGGTCCTTTCACAACAGAATTAT
TTAATGAAGAAGGCGAGACAATTGCGCGTAAAGGTAATGAATTTGGTGCG
GTAACGGGACGTCCTCGTCGTTGTGGGTGGTTTGATGCAGTAGCGGTTCG
TCGAGCAGTACAAATTAACTCTATTTCAGGTTTTTGTATGACAAAATTAG
ATGTTTTAGATGGCTTTGAAACGTTAAAAATTTGCACAGCATACAAAATG
CCGAATGGTGAGATTGTAGAATATGCGCCAATGGCCGCAAAAGACTGGGA
AGGTGTTGAACCAATTTATGAAACAATGCCCGGTTGGTCTGAAAATACAT
TTGGTGTGATAAAATATGAAGCGCTTCCGCAAGCTGCACTTGATTATATT
AAAAGGATTGAGGAGTTAGTTGGCGTACCGGTAGATATTCTTTCAACTGG
CCCAGATCGTATTGAAACAATGATTTTACGCGATCCATTTGTGGCATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy