Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1334 IGR1330 IGR1331 IGR1326 IGR1332 IGR1333 IGR1327 IGR1328 IGR1329 rpL35,rpmI, - HD1800 rpL20, - HD1799 infC, - HD1802 HD1805 hflC, - HD1808 hflK, - HD1809 purA, - HD1807 thiI, - HD1806 thrS, - HD1803 HD1804 rpL35,rpmI, - HD1800 rpL20, - HD1799 infC, - HD1802 HD1805 hflC, - HD1808 hflK, - HD1809 purA, - HD1807 thiI, - HD1806 thrS, - HD1803 HD1804 rpL20, - HD1799 infC, - HD1802 HD1805 hflC, - HD1808 hflK, - HD1809 purA, - HD1807 thiI, - HD1806 thrS, - HD1803 rpL35,rpmI, - HD1800 HD1804
* Calculated from Protein Sequence

Gene ID: HD1805

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
MAF-like protein

Gene Start:
1510966

Gene Stop:
1510373

Gene Length:
594

Molecular Weight*:
21654

pI*:
7.10

Net Charge*:
0.30

EC:
 

Functional Class:
Unassigned  

Pathway: pathway table

Secondary Evidence:
Levin PA, Margolis PS, Setlow P, Losick R, Sun D.
Identification of Bacillus subtilis genes for septum
placement and shape determination.
J Bacteriol 1992 Nov;174(21):6717-28.
Medline: 93015731.

Comment:


Blast Summary:  PSI-Blast Search
Residues 4-194 are 53% similar to 15603133| unknown [Pasteurella multocida].

Significant hits to hypothetical / MAF proteins with gapped BLAST; e.g. residues 5-188 are 45% similar to Maf/YceF/YhdE family protein (AE002415) of Neisseria meningitidis, residues 5-191 are 43% similar to orfE (U18997) of E. coli, residues 1-192 are 40% similar to maf protein (M96343) of Bacillus subtilis.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0424
COG name: Putative inhibitor of septum formation
Functional Class: D
The phylogenetic pattern of COG0424 is ---kyqvcEbr-uj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003697 (Maf-like protein) with a combined E-value of 2.2e-40.
    IPB003697A    5-17
    IPB003697B    71-101
    IPB003697C    134-169
    IPB003697D    170-180


ProDom Summary:  Protein Domain Search
Residues 31-180 are 54% similar to a (COMPLETE PROTEOME MAF MAF-TYPE) protein domain (PD005766) which is seen in Q9CLG6_PASMU.



Paralogs:  Local Blast Search

HD1805 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 3 to 195 (E-value = 9.3e-63) place HD1805 in the Maf family which is described as Maf-like protein (PF02545)

PDB Hit:
pdb|1EX2|A Chain A, Crystal Structure Of Bacillus Subtilis Maf ... 135 3e-033

Gene Protein Sequence:
MHKKLYLASNSPRRWALLQNLGLALLPLASEIDETAHANEMAQDYCSRIA
REKNQAAQAVRIRQNLAEYPILTADIMVSIDGEILGKPSHQQQAVEMLKK
LSGRTHQVYTAVCVSANQQLFECIHSSEVTFKRLSEAEIYAYIATGEPMD
KAGAYGIQALGGIFIQHLAGSFTGVMGLPIFETVALLKKVNIEVLPS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCATAAAAAACTTTATCTTGCTTCAAATAGTCCACGTCGTTGGGCATT
ATTACAAAATCTAGGTTTAGCTTTATTACCACTTGCAAGTGAAATAGATG
AAACTGCACATGCAAATGAAATGGCTCAAGATTATTGTTCACGTATTGCT
AGGGAAAAGAATCAAGCGGCTCAAGCAGTTAGAATTCGCCAGAATCTTGC
TGAATATCCGATTCTAACTGCCGATATCATGGTTTCGATTGACGGAGAGA
TTTTAGGCAAGCCAAGTCATCAGCAGCAAGCAGTTGAGATGCTCAAAAAA
TTATCTGGCCGAACTCATCAAGTCTATACGGCAGTCTGTGTAAGTGCTAA
TCAACAACTATTTGAGTGTATTCATAGCAGTGAAGTCACCTTTAAAAGAT
TATCTGAGGCTGAAATTTATGCTTATATTGCAACTGGCGAGCCTATGGAT
AAAGCGGGCGCTTATGGTATTCAAGCACTAGGTGGTATATTTATTCAGCA
TTTAGCAGGCAGTTTTACCGGTGTAATGGGCTTACCTATTTTTGAAACAG
TCGCGTTATTAAAAAAAGTCAATATTGAGGTTTTGCCATCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy