Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1308 IGR1309 IGR1310 IGR1304 IGR1313 IGR1306 IGR1305 IGR1303 IGR1307 IGR1312 IGR1314 IGR1315 IGR1311 HD1780 ybgE, - HD1779 groES, - HD1785 tolA, - HD1774 ybgC, - HD1778 mutT,dgt, - HD1786 tolR, - HD1776 tolA, - HD1775 tolQ, - HD1777 cydB, - HD1781 cydA, - HD1782 groEL, - HD1784 secA, - HD1788 HD1783 HD1780 ybgE, - HD1779 groES, - HD1785 tolA, - HD1774 ybgC, - HD1778 mutT,dgt, - HD1786 tolR, - HD1776 tolA, - HD1775 tolQ, - HD1777 cydB, - HD1781 cydA, - HD1782 groEL, - HD1784 secA, - HD1788 HD1783 ybgE, - HD1779 groES, - HD1785 ybgC, - HD1778 mutT,dgt, - HD1786 tolR, - HD1776 tolA, - HD1775 tolQ, - HD1777 cydB, - HD1781 cydA, - HD1782 groEL, - HD1784 secA, - HD1788 HD1780 tolA, - HD1774 HD1783
* Calculated from Protein Sequence

Gene ID: HD1782

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
cydA  

Definition:
cytochrome D ubiquinol oxidase, subunit I

Gene Start:
1493229

Gene Stop:
1491679

Gene Length:
1551

Molecular Weight*:
57673

pI*:
8.30

Net Charge*:
3.57

EC:
1.10.3.-  

Functional Class:
Energy metabolism; Electron transport  

Pathway: pathway table

Secondary Evidence:
Green GN, Fang H, Lin RJ, Newton G, Mather M, Georgiou CD, Gennis RB.
The nucleotide sequence of terminal oxidase complex of Escherichia coli.
J Biol Chem 1988 Sep 15;263(26):13138-43.
Medline: 88330812.

Bebbington KJ, Williams HD.
A role for DNA supercoiling in the regulation of the cytochrome bd oxidase of Escherichia coli.
Microbiology. 2001 Mar;147(Pt 3):591-8.
PMID: 11238966

Cotter PA, Melville SB, Albrecht JA, Gunsalus RP.
Aerobic regulation of cytochrome d oxidase (cydAB) operon expression in Escherichia coli: roles of Fnr and ArcA in repression and activation.
Mol Microbiol. 1997 Aug;25(3):605-15.
PMID: 9302022

Muller MM, Webster RE.
Characterization of the tol-pal and cyd region of Escherichia coli K-12: transcript analysis and identification of two new proteins encoded by the cyd operon.
J Bacteriol. 1997 Mar;179(6):2077-80.
PMID: 9068659

Comment:
0

Blast Summary:  PSI-Blast Search
Significant hits to cytochrome oxidase D subunit I with gapped BLAST; e.g. residues 1-516 are 74% similar to cytochrome D ubiquinol oxidase, subunit I (U32787) of Haemophilus influenzae Rd, residues 1-515 are 67% similar to cytochrome oxidase d subunit I (J03939) of E. coli, residues 1-515 are 66% similar to subunit I of cytochrome bd (Y10012) of Klebsiella pneumoniae, residues 1-514 are 64% similar to cytochrome d oxidase subunit I (AF001503) of Salmonella typhimurium.

COGS Summary:  COGS Search
BeTs to 8 clades of COG1271
COG name: Cytochrome bd quinol oxidase, subunit 1
Functional Class:  C
The phylogenetic pattern of COG1271 is A----q-cEBrh------inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002585 (Cytochrome bd ubiquinol oxidase, subunit I) with a combined E-value of 3.2e-278.
    IPB002585A    5-41
    IPB002585B    42-66
    IPB002585C    70-99
    IPB002585D    100-145
    IPB002585E    149-187
    IPB002585F    193-234
    IPB002585G    237-286
    IPB002585H    287-317
    IPB002585I    375-397
    IPB002585J    421-459


ProDom Summary:  Protein Domain Search
Residues 428-501 are 90% similar to a (OXIDASE SUBUNIT CYTOCHROME COMPLETE) protein domain (PD344108) which is seen in Q9CM64_PASMU.

Residues 17-294 are 82% similar to a (OXIDASE CYTOCHROME SUBUNIT COMPLETE) protein domain (PD003558) which is seen in Q9CM64_PASMU.

Residues 297-361 are 58% similar to a (I SUBUNIT CYTOCHROME OXIDASE) protein domain (PD014397) which is seen in CYOA_HAEIN.

Residues 364-427 are 48% similar to a (CYTOCHROME I SUBUNIT OXIDASE) protein domain (PD353666) which is seen in Q9KR03_VIBCH.

Residues 364-427 are 67% similar to a (D I PROTEOME CYDA) protein domain (PD412799) which is seen in Q9CM64_PASMU.



Paralogs:  Local Blast Search


HD1782 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 7 to 511 (E-value = 2.2e-295) place HD1782 in the Bac_Ubq_Cox family which is described as Bacterial Cytochrome Ubiquinol Oxidase (PF01654)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MLDVVELSRLQFALTALYHFLFVPLTLGLSFILVVMETLYVTTGKEVYKD
MTKFWGKLFGINFALGVTTGITMEFQFGMNWSYYSHYVGDIFGAPLAIEG
LMAFFLESTFVGIFFFGWDRLSKAKHLLATYCVAFGSNFSALWILVANGW
MQNPIGSEFNFETMRMELVSFSELLLNPVTQSKFLHTATAGYTCAAIFVL
GISAYYILKGRDLGFAKRSFSVGASFGLISIFSVLVMGDESGYEIGKAQP
TKLAAMEGEFETHPAPAAWNVFVIPNMAEMKNEFSIHIPYMAGIIATRSL
DGEIKGLRDIRAINEQRVRSGIKAYGLLEKLRSGNYTEEDKLAFQKVQKD
LGFGLLLKPYTVNVVDATEEQIQKAAASTIPKVGPTFWAFRAMMVSGGLM
LLLILFAFIQNMRGTVGKNRLFLRAMLWGIPLPWIAIESGWFLAEYGRQP
WAIYEVLPTGVANSALTTLDLWISIGLICGLYTLFLIVEMYLMFKYGKLG
PSALKTGRYHFEQSAK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTAGACGTTGTTGAACTCTCTCGCTTGCAGTTTGCGTTAACTGCTCT
CTATCACTTCTTATTTGTGCCGTTAACATTAGGCCTTTCTTTCATTCTCG
TTGTGATGGAAACCCTTTATGTAACGACTGGAAAAGAAGTCTATAAAGAT
ATGACTAAATTCTGGGGTAAGTTATTTGGTATTAACTTTGCTCTTGGTGT
AACAACTGGTATTACAATGGAATTCCAGTTTGGTATGAACTGGTCATATT
ACTCTCATTATGTAGGTGATATCTTTGGCGCTCCGTTAGCGATCGAAGGT
TTAATGGCATTTTTCTTAGAATCAACTTTTGTTGGTATATTCTTCTTTGG
CTGGGATCGTTTATCAAAGGCTAAACATTTATTAGCAACATATTGTGTCG
CATTTGGTTCTAATTTCTCTGCATTATGGATTCTAGTCGCGAATGGCTGG
ATGCAAAACCCAATAGGTTCAGAATTTAATTTTGAAACTATGCGAATGGA
GCTTGTAAGCTTTTCAGAACTTTTATTAAATCCAGTCACTCAATCAAAAT
TCTTGCATACAGCAACAGCAGGGTACACTTGTGCTGCGATTTTTGTATTG
GGTATTAGTGCATATTATATTTTAAAAGGCCGTGATTTAGGCTTTGCAAA
ACGTTCATTTTCGGTTGGTGCAAGTTTTGGTTTGATCTCTATTTTTTCTG
TATTAGTAATGGGAGATGAATCAGGTTATGAAATCGGTAAAGCACAACCG
ACTAAATTAGCCGCAATGGAAGGTGAATTTGAAACTCACCCAGCACCTGC
TGCTTGGAATGTTTTTGTTATTCCAAATATGGCAGAAATGAAAAATGAAT
TTTCAATTCATATCCCCTATATGGCGGGTATCATTGCTACACGTTCTTTA
GATGGTGAAATTAAAGGATTACGTGATATTCGTGCAATCAATGAACAGCG
CGTGCGTTCAGGTATAAAAGCTTATGGATTGCTAGAAAAATTACGTTCAG
GTAATTATACGGAAGAAGACAAATTAGCTTTCCAAAAAGTGCAAAAAGAT
TTAGGTTTTGGTCTATTATTAAAACCATATACCGTAAATGTTGTTGATGC
AACAGAAGAACAAATTCAAAAAGCAGCCGCTAGTACAATCCCTAAGGTAG
GACCTACTTTCTGGGCATTCCGTGCAATGATGGTATCAGGTGGCTTGATG
TTGTTATTGATTTTGTTTGCATTTATTCAAAATATGCGCGGTACAGTAGG
TAAAAATCGCTTGTTTTTACGTGCAATGTTATGGGGTATTCCATTACCGT
GGATTGCGATAGAATCTGGTTGGTTCTTAGCCGAGTATGGTCGTCAACCT
TGGGCTATTTATGAGGTATTACCAACAGGAGTAGCAAATTCTGCATTAAC
TACGTTAGATCTTTGGATCTCTATTGGTTTGATATGTGGTCTATATACTT
TATTCTTAATTGTTGAAATGTATTTAATGTTTAAATATGGCAAATTAGGT
CCAAGTGCATTAAAAACGGGTCGATATCATTTTGAACAATCTGCTAAATA
A


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy