Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1308 IGR1310 IGR1309 IGR1302 IGR1304 IGR1301 IGR1306 IGR1305 IGR1303 IGR1307 IGR1312 IGR1300 IGR1311 HD1780 ybgE, - HD1779 tolA, - HD1774 ybgC, - HD1778 tolR, - HD1776 pal, - HD1772 tolA, - HD1775 tolQ, - HD1777 cydB, - HD1781 tolB, - HD1773 cydA, - HD1782 groEL, - HD1784 HD1783 HD1780 ybgE, - HD1779 tolA, - HD1774 ybgC, - HD1778 tolR, - HD1776 pal, - HD1772 tolA, - HD1775 tolQ, - HD1777 cydB, - HD1781 tolB, - HD1773 cydA, - HD1782 groEL, - HD1784 HD1783 ybgE, - HD1779 tolA, - HD1774 ybgC, - HD1778 tolR, - HD1776 pal, - HD1772 tolA, - HD1775 tolQ, - HD1777 cydB, - HD1781 tolB, - HD1773 cydA, - HD1782 groEL, - HD1784 HD1780 HD1783
* Calculated from Protein Sequence

Gene ID: HD1779

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ybgE  

Definition:
conserved hypothetical protein

Gene Start:
1490407

Gene Stop:
1490117

Gene Length:
291

Molecular Weight*:
11093

pI*:
10.70

Net Charge*:
4.93

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:
HD1779 is part of the tol-cyd cluster of genes common to E. coli, H. ducreyi, A. actinomycetemcomitans, and partially conserved in H. influenzae. HD1779 corresponds to the ybgE component of this cluster.

Blast Summary:  PSI-Blast Search
Residues 1-90 are 38% similar to 15602837 unknown [Pasteurella
multocida].

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD1779 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MIHSIYNLTRKGWLKALSFILALLLFIVILLNPQVFASYFGGHVPYLAIF
VFYGMAILWIHGIGLDIHRTFWQLLFLPIMGYLIVISTLIFLILLK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTCATTCAATTTATAATTTAACAAGAAAGGGCTGGCTCAAGGCCCT
TTCTTTTATTCTTGCATTATTACTTTTTATCGTAATTTTGCTTAATCCTC
AGGTATTTGCATCGTACTTTGGTGGACATGTTCCTTATTTAGCAATATTT
GTTTTTTATGGAATGGCTATTTTATGGATTCATGGTATTGGGCTTGATAT
CCACCGCACTTTTTGGCAATTACTTTTTTTACCAATTATGGGTTATTTAA
TTGTTATTAGTACATTAATATTTCTAATATTATTAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy