Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1302 IGR1304 IGR1301 IGR1306 IGR1298 IGR1305 IGR1303 IGR1299 IGR1297 IGR1300 tolA, - HD1774 ybgC, - HD1778 tolR, - HD1776 pal, - HD1772 tolA, - HD1775 tolQ, - HD1777 dnaJ, - HD1771 HD1769 moeA,chlE, - HD1767 tolB, - HD1773 yheS, - HD1768 tolA, - HD1774 ybgC, - HD1778 tolR, - HD1776 pal, - HD1772 tolA, - HD1775 tolQ, - HD1777 dnaJ, - HD1771 HD1769 moeA,chlE, - HD1767 tolB, - HD1773 yheS, - HD1768 tolA, - HD1774 ybgC, - HD1778 tolR, - HD1776 pal, - HD1772 tolA, - HD1775 tolQ, - HD1777 dnaJ, - HD1771 HD1769 moeA,chlE, - HD1767 tolB, - HD1773 HD1770 HD1770 yheS, - HD1768
* Calculated from Protein Sequence

Gene ID: HD1771

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
dnaJ  

Definition:
heat shock protein dnaJ-related

Gene Start:
1485257

Gene Stop:
1484370

Gene Length:
888

Molecular Weight*:
33506

pI*:
9.90

Net Charge*:
7.35

EC:
 

Functional Class:
Cellular processes; Chaperones  

Pathway: pathway table

Secondary Evidence:
Cyr DM, Langer T, Douglas MG.
DnaJ-like proteins: molecular chaperones and specific regulators of Hsp70.
Trends Biochem Sci 1994 Apr;19(4):176-81.
Medline: 94287451.

Comment:
For other "dna" genes, see HD1372 (dnaB), HD0973 (dnaB), HD1819 (dnaX), HD0189 (dnaK), HD1935 (dnaX), HD0551 (dnaE), HD0690 (dnaG), HD0850 (dnaN), HD0851 (dnaA)

Blast Summary:  PSI-Blast Search
Significant hits to DnaJ proteins with gapped BLAST; e.g. residues
41-295 are 59% similar to DnaJ like protein (U32713) of Haemophilus influenzae, residues 40-295 are 44% similar to DnaJ-like protein (AE000116) of E. coli, residues
64-194 are 31% similar to DjlA protein (AJ011775) of Legionella pneumophila.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0484
COG name: Molecular chaperones, DnaJ family (contain C-terminal Zn finger domain)
Functional Class:  O
The phylogenetic pattern of COG0484 is --t-YQVCebRhUjGPOLinx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB001305 (DnaJ central domain (CXXCXGXG)) with a combined E-value of 2e-07.
    IPB001305A    229-261
***** IPB001623 (DnaJ N-terminal domain) with a combined E-value of 6.5e-06.
    IPB001623A    245-259


ProDom Summary:  Protein Domain Search
Residues 40-191 are 65% similar to a (TRANSMEMBRANE INNER DNAJ-LIKE CHAPERONE) protein domain (PD023036) which is seen in Q9CJW3_PASMU.

Residues 229-286 are 79% similar to a (CHAPERONE HEAT SHOCK REPEAT REPLICATION METAL-BINDING) protein domain (PD000231) which is seen in DJLA_HAEIN.



Paralogs:  Local Blast Search


HD1771 is paralogously related to HD0188 (1e-05).


Pfam Summary:  Pfam Search
Residues 229 to 293 (E-value = 8.5e-12) place HD1771 in the DnaJ family which is described as DnaJ domain (PF00226)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LFSNIKGQKMQFIGKIIGFFIGYKLFGGLFGGLLGIFIGHLADKKLYELG
SVRSSIFGKNLTRQSLFMQTTFAVLGHIAKAKGRVTEDDIQLARQLMVRL
RLDNANQQLAQQAFTLGKEANFPLRQVIQEFREACGQRADLLRFFVEVQM
QAAAQDGQLDINEQQILFTIAETIGMSRFQFEQMLAMVMAAQQFRSGGFY
QQYSQQQGSYQQHSYDGYQYSNNGPNIKDAYTVLGINENDEHNAVKRAYR
KLMNEHHPDKLAAKGLPDEMMELAKEKAQQIQAAYDLICKTKGWK$

Gene Nucleotide Sequence:  Sequence Viewer
TTGTTTTCCAATATAAAAGGACAAAAAATGCAATTTATTGGCAAAATCAT
CGGGTTTTTTATTGGTTATAAGCTATTTGGTGGATTATTTGGCGGTTTAC
TTGGGATTTTTATAGGCCATTTGGCAGATAAAAAATTGTATGAATTAGGC
AGTGTTCGTTCATCTATTTTTGGTAAAAATTTAACACGTCAATCTCTATT
TATGCAGACGACTTTTGCCGTGCTTGGCCATATTGCAAAAGCAAAAGGGC
GAGTCACAGAAGATGATATTCAATTAGCTCGGCAATTAATGGTTCGTTTA
CGTTTAGATAATGCGAATCAACAGTTGGCTCAACAAGCATTTACTTTAGG
CAAGGAAGCTAATTTTCCGTTACGCCAAGTTATTCAAGAGTTTCGGGAAG
CGTGTGGGCAACGTGCAGATTTATTGCGTTTTTTTGTGGAAGTTCAGATG
CAAGCAGCGGCTCAAGATGGCCAGTTAGATATCAATGAGCAACAAATTTT
ATTTACTATTGCCGAAACAATAGGTATGTCGCGTTTTCAATTTGAGCAAA
TGTTGGCAATGGTAATGGCGGCACAACAATTTCGATCTGGTGGTTTCTAT
CAGCAATATTCGCAACAACAAGGTTCCTACCAACAGCATTCATACGATGG
CTACCAATACTCAAATAATGGCCCTAATATCAAAGATGCATATACGGTAT
TGGGTATTAATGAAAATGATGAGCATAATGCAGTTAAACGTGCATACCGT
AAATTGATGAATGAACATCACCCTGATAAATTGGCAGCAAAAGGATTACC
TGATGAAATGATGGAGCTAGCCAAGGAAAAAGCACAACAAATTCAGGCCG
CTTATGATCTTATTTGTAAAACGAAAGGGTGGAAGTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy