Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1289 IGR1294 IGR1292 IGR1288 IGR1291 IGR1290 IGR1293 IGR1295 IGR1296 ruvA, - HD1758 pyrE, - HD1759 rluD, - HD1762 HD1760 ruvB, - HD1757 hepA, - HD1764 ampD, - HD1761 yjcD, - HD1756 trmA, - HD1765 ruvA, - HD1758 pyrE, - HD1759 rluD, - HD1762 HD1760 ruvB, - HD1757 hepA, - HD1764 ampD, - HD1761 yjcD, - HD1756 trmA, - HD1765 ruvA, - HD1758 pyrE, - HD1759 rluD, - HD1762 HD1760 ruvB, - HD1757 hepA, - HD1764 ampD, - HD1761 yjcD, - HD1756 trmA, - HD1765
* Calculated from Protein Sequence

Gene ID: HD1762

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
rluD  

Definition:
pseudouridine synthase RluD

Gene Start:
1473367

Gene Stop:
1472699

Gene Length:
669

Molecular Weight*:
25375

pI*:
9.90

Net Charge*:
8.50

EC:
4.2.1.70  

Functional Class:
Translation; Ribosomal proteins: synthesis and modification  

Pathway: pathway table
Pyrimidine metabolism

Secondary Evidence:
Wrzesinski J, Nurse K, Bakin A, Lane BG, Ofengand J. A dual-specificity pseudouridine synthase: an Escherichia coli synthase purified and cloned on the basis of its specificity for psi 746 in 23S RNA is also specific for psi 32 in tRNA(phe).
RNA 1995 Jun;1(4):437-48. Medline: 96079974.

Comment:


Blast Summary:  PSI-Blast Search
Significant hits to pseudouridine synthases / hypothetical proteins with gapped BLAST; e.g. residues 1-22 are 67% similar to pseudouridine synthase (U32744) of Haemophilus influenzae, residues 1-22 are 60% similar to pseudouridine synthase (AE000116) of E. coli, residues 14-216 are 36% similar to conserved hypothetical protein (AE001724) of Thermotoga maritima, residues 14-215 are 30% similar to hypothetical protein (D90914) of Synechocystis sp.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0564
COG name: Predicted pseudouridylate synthase family 2
Functional Class: J
The phylogenetic pattern of COG0564 is ----YqVCEBRHUJGPOLINX
Number of proteins in this genome belonging to this COG is 4

Blocks Summary:  Blocks Search
***** IPB000613 (Pseudouridine synthase) with a combined E-value of 4.1e-46.
    IPB000613A    16-36
    IPB000613B    60-99
    IPB000613C    161-185
    IPB000613D    195-208
***** IPB002990 (Pseudouridine synthase, Rlu family) with a combined E-value of 1e-41.
    IPB002990A    16-36
    IPB002990B    60-98
    IPB002990C    161-185


ProDom Summary:  Protein Domain Search
Residues 14-121 are 70% similar to a (SYNTHASE PSEUDOURIDINE COMPLETE PROTEOME RIBOSOMAL) protein domain (PD001819) which is seen in Q9CK02_PASMU.

Residues 123-222 are 71% similar to a (SYNTHASE PROTEOME COMPLETE PSEUDOURIDINE RIBOSOMAL LARGE) protein domain (PD350148) which is seen in Q9CK02_PASMU.

Residues 135-184 are 52% similar to a (SYNTHASE COMPLETE PROTEOME PSEUDOURIDINE RIBOSOMAL LARGE) protein domain (PD224882) which is seen in Q9ZDR7_RICPR.



Paralogs:  Local Blast Search

HD1762 is paralogously related to HD0645 (1e-23), HD1138 (7e-23) and HD0469 (4e-21).


Pfam Summary:  Pfam Search
Residues 22 to 173 (E-value = 7.9e-55) place HD1762 in the PseudoU_synth_2 family which is described as RNA pseudouridylate synthase (PF00849)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MALIEYHPPLNPFLEEVYRDNHIVVINKPSGLLSVPGNRPEYYDSVMTRV
QQRYGFAEPAHRLDMATSGIILLALSKVAEKELKRQFRDREPKKHYIALL
WGKLGDRVGQTGEINFPLICDWENRPRQKICYERGKKATTHYEVLEHLAN
NTTRVKFTPITGRSHQLRVHSLALGHPIIGDKFYANPLAKSLAPRLCLHA
ESLTIAHPISAELMTFNTEPTF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCATTAATAGAATATCATCCACCACTTAATCCTTTTTTAGAGGAAGT
GTATCGCGATAATCATATTGTCGTGATTAACAAACCTAGTGGTTTATTAT
CTGTCCCGGGCAATCGACCAGAATATTACGATAGCGTCATGACTCGTGTG
CAACAAAGGTATGGCTTTGCTGAACCGGCTCATCGTTTAGATATGGCAAC
GAGCGGTATTATTTTATTAGCTTTAAGTAAAGTGGCAGAGAAAGAACTTA
AACGGCAGTTTCGAGATCGGGAACCCAAAAAACATTACATTGCTTTACTG
TGGGGGAAGTTAGGTGATCGAGTAGGGCAAACGGGAGAAATTAATTTTCC
GCTTATTTGTGATTGGGAAAATCGACCGCGACAAAAAATTTGTTATGAGC
GTGGTAAAAAAGCAACAACACATTATGAAGTGCTTGAACACTTAGCCAAT
AACACCACGCGCGTCAAATTTACGCCAATTACTGGCCGTTCACATCAATT
AAGAGTACATTCATTAGCATTAGGCCATCCGATTATTGGTGATAAATTTT
ATGCGAACCCGTTAGCGAAAAGTTTAGCACCGCGTTTATGTTTACATGCA
GAAAGTTTGACGATTGCTCATCCGATTTCTGCTGAATTGATGACTTTTAA
TACAGAACCCACTTTTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy