Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1289 IGR1286 IGR1294 IGR1292 IGR1288 IGR1291 IGR1290 IGR1293 IGR1287 ruvA, - HD1758 pyrE, - HD1759 rluD, - HD1762 HD1760 ruvB, - HD1757 hepA, - HD1764 rsgB,ftnB, - HD1755 ampD, - HD1761 rsgA,ftnA, - HD1754 secF, - HD1753 yjcD, - HD1756 ruvA, - HD1758 pyrE, - HD1759 rluD, - HD1762 HD1760 ruvB, - HD1757 hepA, - HD1764 rsgB,ftnB, - HD1755 ampD, - HD1761 rsgA,ftnA, - HD1754 secF, - HD1753 yjcD, - HD1756 ruvA, - HD1758 pyrE, - HD1759 rluD, - HD1762 HD1760 ruvB, - HD1757 hepA, - HD1764 rsgB,ftnB, - HD1755 ampD, - HD1761 secF, - HD1753 yjcD, - HD1756 rsgA,ftnA, - HD1754
* Calculated from Protein Sequence

Gene ID: HD1759

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
pyrE  

Definition:
orotate phosphoribosyltransferase

Gene Start:
1470953

Gene Stop:
1470297

Gene Length:
657

Molecular Weight*:
24269

pI*:
6.80

Net Charge*:
-0.42

EC:
2.4.2.10  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Pyrimidine ribonucleotide biosynthesis  

Pathway: pathway table
Pyrimidine metabolism

Secondary Evidence:
Poulsen P, Jensen KF, Valentin-Hansen P, Carlsson P, Lundberg LG.
Nucleotide sequence of the Escherichia coli pyrE gene and of the DNA in front of the protein-coding region.
Eur J Biochem 1983 Sep 15;135(2):223-9.
Medline: 83287414.

Watrin L, Lucas S, Purcarea C, Legrain C, Prieur D.
Isolation and characterization of pyrimidine auxotrophs, and molecular cloning of the pyrE gene from the hyperthermophilic archaeon Pyrococcus abyssi.
Mol Gen Genet. 1999 Sep;262(2):378-81.
PMID: 10517335

Jensen KF.
The Escherichia coli K-12 "wild types" W3110 and MG1655 have an rph frameshift mutation that leads to pyrimidine starvation due to low pyrE expression levels.
J Bacteriol. 1993 Jun;175(11):3401-7.
PMID: 8501045

Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits to orotate phosphoribosyltransferases
with gapped BLAST; e.g. residues 6-218 are 75% similar to orotate phosphoribosyltransferase (U32713) of Haemophilus influenzae Rd, residues 6-218 are 66% similar to orotate phosphoribosyltransferase (L10328) of E. coli, residues 6-218 are 65% similar to orotate phosphoribosyltransferase (Z19547) of Salmonella typhimurium, residues 6-218 are 52% similar to orotate
phosphoribosyltransferase (AL162753) of Neisseria meningitidis.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0461
COG name: Orotate phosphoribosyltransferase
Functional Class:  F
The phylogenetic pattern of COG0461 is amtkYqvcebrhuj-----n-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002375 (Purine/pyrimidine phosphoribosyl transferase) with a combined E-value of 3.6e-06.
    IPB002375A    104-108
    IPB002375B    122-137


ProDom Summary:  Protein Domain Search
Residues 126-218 are 75% similar to a (TRANSFERASE GLYCOSYLTRANSFERASE OROTATE) protein domain (PD005574) which is seen in Q9CJW4_PASMU.

Residues 18-122 are 77% similar to a (TRANSFERASE GLYCOSYLTRANSFERASE OROTATE) protein domain (PD001420) which is seen in PYRE_HAEIN.

Residues 9-124 are 41% similar to a (GLYCOSYLTRANSFERASE PYROPHOSPHORYLASE) protein domain (PD397983) which is seen in O93848_EXODE.



Paralogs:  Local Blast Search

HD1759 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 40 to 175 (E-value = 1.1e-30) place HD1759 in the Pribosyltran family which is described as Phosphoribosyl transferase domain (PF00156)

PDB Hit:
pdb|1ORO|A Chain A, A Flexible Loop At The Dimer Interface Is A... 291 5e-080
pdb|1OPR| Mol_id: 1; Molecule: Orotate Phosphoribosyltransfer... 287 8e-079
pdb|1STO| Orotate Phosphoribosyltransferase (Oprtase) (E.C.2... 285 4e-078

Gene Protein Sequence:
LRGIEMEQYKYDFIEFALSRNVLKFGEFTLKSGRISPYFFNAGLFNTGRD
LAKLGEYYATAIQASQIEYDVLFGPAYKGIPIATTVAVALANQFAIDKPC
CFNRKEAKTHGEGGQLIGAVLEGKILLVDDVITAGTAIRESMQLIKLNQA
SLAGVMIALNRQEKGNGELSAIQEVERDYACQVHSIINFDDLVYFIEQSA
KHAPYLTKMREYRAKYGV$

Gene Nucleotide Sequence:  Sequence Viewer
TTGAGAGGAATTGAAATGGAACAATATAAATATGATTTTATTGAATTTGC
CTTAAGTCGCAATGTATTAAAATTTGGTGAATTTACTTTAAAATCAGGCC
GCATAAGTCCTTATTTTTTTAATGCGGGCTTATTTAATACGGGGCGTGAT
CTAGCAAAGTTAGGTGAATATTATGCAACAGCGATTCAAGCCAGCCAGAT
TGAATATGATGTCTTGTTTGGGCCCGCTTATAAAGGTATCCCGATCGCCA
CGACAGTAGCGGTTGCTTTAGCCAATCAATTTGCTATTGACAAACCTTGT
TGTTTTAATCGAAAAGAAGCTAAAACGCATGGAGAAGGGGGGCAATTAAT
TGGCGCAGTTTTAGAGGGTAAAATTTTATTGGTAGATGATGTGATTACAG
CCGGCACAGCAATTCGTGAATCAATGCAATTAATTAAATTAAATCAAGCC
AGTTTAGCTGGTGTAATGATTGCCTTAAACCGCCAAGAGAAAGGAAATGG
CGAATTATCAGCTATTCAAGAAGTTGAACGAGATTATGCTTGCCAAGTGC
ATTCAATTATTAATTTTGATGATTTAGTTTATTTCATCGAACAATCAGCT
AAACACGCACCTTACTTAACTAAAATGCGAGAATATCGAGCTAAATATGG
TGTTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy