Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1285 IGR1284 IGR1286 IGR1282 IGR1280 IGR1283 IGR1281 IGR1287 HD1747 rec, - HD1749 uup-A, - HD1745 gyrA,parC, - HD1748 HD1746 HD1751 rsgB,ftnB, - HD1755 rsgA,ftnA, - HD1754 ubiG, - HD1750 secF, - HD1753 secD, - HD1752 HD1747 rec, - HD1749 uup-A, - HD1745 gyrA,parC, - HD1748 HD1746 HD1751 rsgB,ftnB, - HD1755 rsgA,ftnA, - HD1754 ubiG, - HD1750 secF, - HD1753 secD, - HD1752 HD1747 rec, - HD1749 uup-A, - HD1745 gyrA,parC, - HD1748 HD1746 HD1751 rsgB,ftnB, - HD1755 rsgA,ftnA, - HD1754 ubiG, - HD1750 secF, - HD1753 secD, - HD1752
* Calculated from Protein Sequence

Gene ID: HD1750

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ubiG  

Definition:
3-demethylubiquinone-9 3-methyltransferase

Gene Start:
1461805

Gene Stop:
1462515

Gene Length:
711

Molecular Weight*:
26588

pI*:
6.40

Net Charge*:
-3.16

EC:
2.1.1.64  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Menaquinone and ubiquinone  

Pathway: pathway table
Ubiquinone biosynthesis

Comment:


Blast Summary:  PSI-Blast Search
Positions 2 to 230 are 76.4% ( EScore : 2e-77 ) similar to sp|P17993|UBIG_ECOLI 3-DEMETHYLUBIQUINONE-9 3-METHYLTRANSFERASE between positions 10 and 234 in [Escherichia coli]
Positions 26 to 236 are 76.3% ( EScore : 7e-68 ) similar to sp|P37431|UBIG_SALTY 3-DEMETHYLUBIQUINONE-9 3-METHYLTRANSFERASE between positions 1 and 207 in [Salmonella typhimurium]

COGS Summary:  COGS Search
BeTs to 3 clades of COG2227
COG name: 2-Octaprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase UbiG/COQ3
Functional Class: H
The phylogenetic pattern of COG2227 is ----y---e-----------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000339 (ubiE/COQ5 methyltransferase family) with a combined E-value of 1.6e-09.
    IPB000339B    51-65
    IPB000339C    72-89
    IPB000339D    116-158
***** IPB001566 (RNA methyltransferase trmA family) with a combined E-value of 6.4e-06.
    IPB001566A    52-93


ProDom Summary:  Protein Domain Search
Residues 1-49 are 71% similar to a (METHYLTRANSFERASE 3-DEMETHYLUBIQUINONE-9) protein domain (PD015722) which is seen in Q9CMI6_PASMU.

Residues 50-97 are 72% similar to a (METHYLTRANSFERASE COMPLETE PROTEOME ARGININE) protein domain (PD006760) which is seen in Q9CMI6_PASMU.

Residues 49-173 are 32% similar to a (PROTEOME COMPLETE) protein domain (PD074418) which is seen in P72896_SYNY3.

Residues 123-234 are 73% similar to a (METHYLTRANSFERASE 3-DEMETHYLUBIQUINONE-9 DHHB) protein domain (PD074484) which is seen in Q9CMI6_PASMU.



Paralogs:  Local Blast Search
HD1750 is paralogously related to HD0016 (1e-04), HD1050 (2e-04) and HD1632 (7e-04).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MHNVDQQELSKFEQMAHSWWDPNGSFKPIHLLNPLRFNYIQTKANGLFGK
KVLDVGCGGGILSEAMAQAGAIVTGIDMTTEPLEIAKQHAIENGLTIHYQ
QTTVEDLRLNHTACNAEKFDVVTCMEMLEHVPDPLSVIQSCKALLKPDGV
LFLSTINRTLKAYMLVVIGAEYLLKMLPKGTHEFEKFIKPAELLTWCDQA
SLECKEMKGYHFNPLTEKFWLNNDVSCNYIAMLKAK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCACAACGTTGATCAGCAAGAACTATCAAAATTTGAGCAGATGGCCCA
CTCTTGGTGGGATCCGAATGGCAGTTTTAAACCAATTCATTTGCTAAATC
CCTTACGTTTTAATTATATCCAAACAAAAGCAAATGGTTTATTTGGTAAA
AAAGTGTTAGATGTTGGTTGTGGTGGCGGTATTTTAAGTGAAGCTATGGC
ACAGGCAGGTGCAATTGTCACAGGTATTGATATGACAACTGAGCCACTAG
AAATTGCCAAACAACACGCAATTGAGAATGGGTTAACTATACATTATCAA
CAAACGACGGTTGAAGATTTACGCCTCAATCATACCGCTTGTAACGCAGA
AAAATTTGATGTGGTGACTTGTATGGAAATGTTAGAACACGTACCCGATC
CACTCTCCGTAATTCAAAGTTGTAAAGCGTTATTAAAGCCAGATGGTGTG
CTATTTTTATCTACGATCAATCGTACGCTAAAAGCTTATATGTTGGTGGT
TATTGGCGCAGAATACTTATTGAAAATGTTGCCCAAAGGCACGCATGAAT
TTGAAAAGTTTATTAAGCCTGCGGAATTATTAACCTGGTGTGATCAAGCT
AGCCTAGAATGTAAGGAAATGAAAGGCTATCACTTTAACCCGTTAACTGA
AAAATTTTGGTTAAATAATGACGTTAGCTGTAATTATATCGCGATGTTGA
AAGCCAAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy