Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1285 IGR1284 IGR1286 IGR1282 IGR1280 IGR1283 IGR1281 HD1747 rec, - HD1749 uup-A, - HD1745 gyrA,parC, - HD1748 HD1746 HD1751 rsgB,ftnB, - HD1755 rsgA,ftnA, - HD1754 ubiG, - HD1750 secF, - HD1753 secD, - HD1752 HD1747 rec, - HD1749 uup-A, - HD1745 gyrA,parC, - HD1748 HD1746 HD1751 rsgB,ftnB, - HD1755 rsgA,ftnA, - HD1754 ubiG, - HD1750 secF, - HD1753 secD, - HD1752 HD1747 rec, - HD1749 uup-A, - HD1745 gyrA,parC, - HD1748 HD1746 HD1751 rsgA,ftnA, - HD1754 ubiG, - HD1750 secF, - HD1753 secD, - HD1752 rsgB,ftnB, - HD1755
* Calculated from Protein Sequence

Gene ID: HD1749

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
rec  

Definition:
possible endonuclease V

Gene Start:
1461741

Gene Stop:
1461361

Gene Length:
381

Molecular Weight*:
14796

pI*:
10.10

Net Charge*:
5.86

EC:
3.1.25.1  

Functional Class:
Replication; Degradation of DNA  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 1-126 are 76% similar to 15602310 unknown [Pasteurella
multocida].

Residues 1 to 126 are 41% ( EScore : 8e-20 ) identical to gb|AAD33352.1| (AF128129) pyrimidine dimer-specific glycosylase between residues 1 and 137 in [Chlorella virus]
Residues 1 to 126 are 43% ( EScore : 1e-19 ) identical to ref|NP_048398.1|| Bacteriophage T4 endonuclease V homolog, refer to Swiss-Prot Accession Number P04418 >7461231|pir||T17540 endonuclease V-like protein - Chlorella virus PBCV-1 >624073|gb|AAC96418.1| between residues 1 and 137 in [Chlorella virus]
Residues 1 to 126 are 43% ( EScore : 1e-19 ) identical to gb|AAD33350.1| (AF128127) pyrimidine dimer-specific glycosylase [Chlorella virus] >4928002|gb|AAD33351.1| between residues 1 and 137 in [Chlorella virus]
Residues 1 to 126 are 41% ( EScore : 1e-19 ) identical to gb|AAD33367.1| (AF128144) pyrimidine dimer-specific glycosylase between residues 1 and 137 in [Chlorella virus]
Residues 1 to 126 are 43% ( EScore : 1e-19 ) identical to gb|AAD33374.1| (AF128151) pyrimidine dimer-specific glycosylase between residues 1 and 137 in [Chlorella virus]
Residues 1 to 126 are 41% ( EScore : 1e-19 ) identical to gb|AAD33357.1| (AF128134) pyrimidine dimer-specific glycosylase [Chlorella virus] >4928010|gb|AAD33359.1| between residues 1 and 137 in [Chlorella virus]
Residues 1 to 126 are 41% ( EScore : 2e-19 ) identical to gb|AAD33369.1| (AF128146) pyrimidine dimer-specific glycosylase between residues 1 and 137 in [Chlorella virus]
Residues 1 to 126 are 41% ( EScore : 2e-19 ) identical to gb|AAD33389.1| (AF128166) pyrimidine dimer-specific glycosylase between residues 1 and 137 in [Chlorella virus]
Residues 1 to 124 are 41% ( EScore : 4e-19 ) identical to gb|AAD33371.1| (AF128148) pyrimidine dimer-specific glycosylase [Chlorella virus] >4928023|gb|AAD33372.1| between residues 1 and 135 in [Chlorella virus]
Residues 1 to 124 are 41% ( EScore : 4e-19 ) identical to gb|AAD33362.1| (AF128139) pyrimidine dimer-specific glycosylase between residues 1 and 135 in [Chlorella virus]

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-119 are 78% similar to a (GLYCOSYLASE DIMER-SPECIFIC PYRIMIDINE) protein domain (PD021350) which is seen in Q9CNI6_PASMU.



Paralogs:  Local Blast Search
HD1749 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 126 (E-value = 1.8e-30) place HD1749 in the Pyr_excise family which is described as Pyrimidine dimer DNA glycosylase (PF03013)

PDB Hit:
pdb|2END| Endonuclease V (E.C.3.1.25.1) 87 1e-018
pdb|1ENK| Endonuclease V (E.C.3.1.25.1) Mutant With Glu 23 R... 86 2e-018
pdb|1ENJ| Endonuclease V (E.C.3.1.25.1) Mutant With Glu 23 R... 86 2e-018

Gene Protein Sequence:
MTRINLVPPAELCDQHLLAEHRELTRIPNTIAKGKFKLAGQPSDYKLGEG
HVRFFFNKLAFLKQRYDALHEECLARGFNVQYFWTEDLPQDPALWLDYQP
TENALKINRARIAERMPAKVRFTQRK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTAGAATTAATCTTGTTCCACCCGCTGAATTATGTGATCAACATTT
ACTGGCTGAACATAGAGAATTAACACGCATACCCAATACCATCGCTAAAG
GTAAATTTAAATTAGCGGGGCAGCCTAGTGATTACAAATTAGGTGAAGGA
CACGTCCGCTTCTTCTTTAATAAATTAGCCTTTTTAAAACAACGCTATGA
TGCTTTGCACGAAGAATGTTTGGCTCGAGGTTTTAATGTGCAATACTTTT
GGACAGAAGATTTACCACAAGATCCTGCACTTTGGTTAGATTACCAGCCT
ACAGAAAATGCTTTAAAAATCAATCGAGCAAGAATTGCTGAACGAATGCC
AGCAAAAGTACGTTTCACGCAAAGAAAATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy