Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1285 IGR1284 IGR1279 IGR1282 IGR1280 IGR1283 IGR1281 IGR1278 HD1747 rec, - HD1749 hemX, - HD1742 ygdL, - HD1744 uup-A, - HD1745 gyrA,parC, - HD1748 HD1746 HD1751 ubiG, - HD1750 secF, - HD1753 secD, - HD1752 HD1747 rec, - HD1749 hemX, - HD1742 ygdL, - HD1744 uup-A, - HD1745 gyrA,parC, - HD1748 HD1746 HD1751 ubiG, - HD1750 secF, - HD1753 secD, - HD1752 HD1747 rec, - HD1749 hemX, - HD1742 ygdL, - HD1744 uup-A, - HD1745 gyrA,parC, - HD1748 HD1746 HD1751 ubiG, - HD1750 secF, - HD1753 secD, - HD1752
* Calculated from Protein Sequence

Gene ID: HD1748

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
gyrA  parC  

Definition:
DNA gyrase / topoisomerase IV, subunit A

Gene Start:
1461247

Gene Stop:
1458545

Gene Length:
2703

Molecular Weight*:
99827

pI*:
5.30

Net Charge*:
-22.76

EC:
5.99.1.3  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Comment:
For other "gyr" genes, see HD1587 (gyrA), HD0870 (gyrB), HD1643 (gyrB). For other topoisomerases, see HD0413 (I), HD0954 (I), HD1276 (III), HD1385 (I), HD1643(II).

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to DNA gyrase subunit A protein; e.g. positions 4 to 886 are 74% (EScore: 0.0) similar to sp|P43700|GYRA_HAEIN DNA gyrase, subunit A >1074018|pir||E64113 DNA topoisomerase between positions 5 and 874 in Haemophilus influenzae Rd. Positions 1 to 899 are 69% (EScore: 0.0) similar to dbj|BAA77788.1| (AB023569) DNA gyrase between positions 1 and 860 in Vibrio parahaemolyticus.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0188
COG name: DNA gyrase (topoisomerase II) A subunit
Functional Class: L
The phylogenetic pattern of COG0188 is a---yqvCEBrHujGPOlINX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB002205 (DNA gyrase/topoisomerase IV, subunit A) with a combined E-value of 2e-92.
    IPB002205A    32-50
    IPB002205B    65-100
    IPB002205C    113-127
    IPB002205D    169-190
    IPB002205E    212-221
    IPB002205F    231-240


ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD1748 is paralogously related to HD1587 (1e-100).


Pfam Summary:  Pfam Search
Residues 536 to 585 (E-value = 1.3e-14) place HD1748 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)
Residues 586 to 640 (E-value = 3.9e-11) place HD1748 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)
Residues 646 to 693 (E-value = 1.5e-08) place HD1748 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)
Residues 694 to 741 (E-value = 8.1e-09) place HD1748 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)
Residues 778 to 828 (E-value = 8.6e-15) place HD1748 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)
Residues 829 to 878 (E-value = 5e-14) place HD1748 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)

PDB Hit:
pdb|1AB4| 59kda Fragment Of Gyrase A From E. Coli 698 0.0
pdb|1BJT| Topoisomerase Ii Residues 409 - 1201 >gi|1633273|p... 79 2e-015

Gene Protein Sequence:
MSELAKDITPVSIEDELKTSYLDYAMSVIVGRALPDVRDGLKPVHRRVLF
SMDRNSNTFNKPHVKSARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRY
MLVDGQGNFGSIDGDAPAAMRYTEVRMQKITQELLTDLDKETVDYSPNYD
GKEMIPDVLPTKIPALLVNGSSGIAVGMATNIPPHNLNEVLDGCLAYIEN
DQLSIEELMRFIPGPDFPTGAIINGRKGIEDAYCTGRGKVYVRAKATVEK
TEKNREQIIVTELPYQVNKAKLIEKIAELVKDKKIDGISSIQDHSDKKGI
SIVIEIKRDAVGEVVLNHLYSLTQMQVTFGINMVALDHGQPKVLNLKQII
EAFVKHRREVVTRRTIFELRKARERAHILEGLAIALANIDPVIELIRQSK
TAEEARLALLDRAWSLGNVAPMLEAAGVDASRPEDLAVELGVHNGEYHLS
EAQARAILELRLHRLTGLEHEKIVDEYKQLLTEIGELLHILNSAERLMQV
IREELEKVKAEFGDERRTEITAASGDINLEDLIAQEDVVVTLSHAGYVKY
QPLSDYEAQRRGGKGKSATKMKEDDFIEKLLVANTHDTILCFSSRGRLYQ
LKVYQLPQASRGARGTPIVNILPLVKEENERITAILPIPKGEFSTDKFIF
MATASGIVKKVCLDAFSHIRSSGLITLKLREGDELIGVDITDGGSEIMLF
SAQGRVVRFAEKAVRSMGRTATGVRGIKLATSDILADDIEDTEIVEIEQE
ETEDNTAVNLNIDRVVSLVIPRADIATSGDILTVTENGYGKRTVLTEYPI
KSRATKGVLSIKVNERNGKVVAAVQVDELDQIMLITDAGTLVRTRVAEVS
LVGRNTQGVRIIRTAEDEKVVSLERLCEPEEDESNELQRDTEVIETSTEA
$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCGAATTAGCCAAAGATATTACTCCCGTCAGTATTGAAGACGAATT
AAAAACGTCTTATCTAGACTATGCGATGTCAGTGATTGTAGGCCGTGCAT
TACCAGATGTGCGTGACGGCTTAAAACCGGTACACCGCCGTGTATTATTC
TCAATGGATCGAAATAGCAATACCTTTAACAAACCACACGTCAAATCAGC
ACGCGTGGTTGGTGATGTAATCGGTAAATATCACCCACACGGTGATTCTG
CTGTTTATGACACCATTGTCCGCATGGCACAGCCTTTCTCGCTCCGCTAT
ATGTTAGTCGACGGCCAAGGTAACTTTGGTTCAATTGACGGTGATGCACC
GGCAGCAATGCGTTATACCGAAGTTCGTATGCAGAAAATTACTCAGGAAT
TATTGACTGATTTAGACAAAGAAACGGTCGATTACTCGCCAAACTATGAT
GGCAAAGAAATGATTCCTGATGTATTACCCACTAAAATTCCCGCGTTATT
GGTTAATGGGTCTTCTGGTATTGCCGTGGGTATGGCAACCAATATTCCAC
CGCATAATCTAAATGAAGTATTAGACGGTTGCCTTGCTTATATTGAAAAT
GATCAACTTAGCATTGAAGAATTAATGCGATTTATCCCAGGCCCAGACTT
TCCAACGGGAGCCATTATCAATGGTCGTAAAGGGATTGAAGATGCTTATT
GTACAGGACGAGGTAAAGTTTATGTACGAGCAAAAGCAACAGTCGAAAAA
ACGGAAAAAAATCGTGAACAGATCATCGTCACTGAATTGCCATATCAAGT
GAATAAAGCCAAATTGATCGAAAAAATTGCTGAATTAGTCAAAGACAAAA
AAATAGACGGAATCAGCAGTATTCAAGATCATTCTGATAAAAAAGGCATC
TCAATTGTGATTGAGATAAAACGAGATGCCGTCGGTGAAGTGGTCCTAAA
TCACTTATATTCATTGACACAAATGCAAGTCACTTTTGGTATTAATATGG
TGGCATTAGATCATGGTCAGCCAAAAGTATTAAATCTCAAACAAATTATT
GAAGCCTTTGTTAAACATCGGCGTGAAGTAGTGACGCGTCGTACAATTTT
TGAATTGCGTAAAGCACGTGAAAGGGCGCATATTTTAGAAGGACTCGCCA
TTGCCTTAGCTAATATAGATCCAGTGATAGAATTGATCCGCCAGTCAAAA
ACTGCGGAAGAAGCCCGCTTAGCATTATTGGATCGCGCTTGGTCATTAGG
CAATGTTGCTCCAATGTTAGAAGCAGCGGGAGTTGACGCCTCTCGACCGG
AAGATTTAGCGGTTGAATTAGGGGTACATAATGGCGAATATCATTTATCT
GAAGCACAAGCACGCGCTATTTTAGAATTACGTTTACACCGCTTAACCGG
CTTAGAACACGAAAAAATTGTTGATGAATACAAACAATTATTAACGGAAA
TCGGCGAATTATTACACATCTTAAACAGTGCTGAACGTTTAATGCAAGTT
ATTCGTGAAGAATTAGAAAAAGTTAAAGCAGAATTTGGTGATGAACGTCG
CACTGAAATCACTGCTGCCTCAGGCGATATCAACTTAGAAGACTTAATTG
CACAAGAAGATGTAGTCGTAACCCTATCACACGCAGGCTATGTTAAATAT
CAACCGCTATCTGACTATGAAGCACAACGCCGAGGCGGTAAAGGTAAATC
TGCAACTAAAATGAAAGAAGATGATTTCATCGAAAAATTACTAGTAGCAA
ATACGCACGACACTATTCTTTGCTTCTCAAGCCGTGGTCGCTTATACCAA
TTAAAAGTTTACCAACTACCACAAGCCAGTCGAGGAGCAAGAGGCACACC
AATTGTCAATATTCTACCACTTGTTAAAGAAGAAAATGAAAGAATTACCG
CCATCTTACCTATTCCAAAAGGCGAATTTTCAACAGATAAATTTATTTTT
ATGGCAACCGCAAGTGGTATCGTCAAGAAAGTCTGTTTAGATGCATTTAG
TCATATACGCTCAAGCGGTCTAATTACGTTAAAACTTCGCGAAGGAGATG
AATTAATCGGCGTAGATATTACTGACGGCGGCAGTGAAATTATGTTGTTC
TCTGCGCAAGGTCGGGTAGTACGCTTTGCAGAAAAAGCTGTTCGCTCAAT
GGGCAGAACCGCAACAGGCGTTCGCGGTATTAAGCTTGCCACAAGCGACA
TACTTGCCGATGATATAGAAGATACTGAAATTGTTGAAATTGAGCAGGAA
GAAACAGAAGATAATACCGCCGTCAATCTAAACATCGATCGCGTAGTATC
ATTGGTCATTCCACGAGCAGATATAGCAACTAGTGGCGATATTCTAACCG
TAACAGAAAACGGCTATGGTAAACGCACCGTCTTAACCGAATACCCAATC
AAATCCCGTGCAACTAAAGGTGTTTTATCAATTAAAGTGAATGAACGTAA
CGGTAAAGTAGTCGCTGCCGTACAAGTAGATGAATTAGATCAAATTATGT
TGATTACCGATGCGGGCACTTTAGTTCGAACACGCGTTGCCGAAGTCAGT
TTAGTGGGTCGAAATACACAAGGCGTACGGATTATCCGCACCGCCGAAGA
TGAAAAAGTTGTTAGCCTTGAACGCCTTTGCGAACCCGAAGAGGATGAAA
GTAACGAACTACAGCGAGACACCGAAGTAATAGAAACTTCAACTGAAGCA
TAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy