Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1277 IGR1276 IGR1275 IGR1279 IGR1280 IGR1274 IGR1278 HD1747 hemX, - HD1742 ygdL, - HD1744 hemY, - HD1740 hemX, - HD1741 ppiD, - HD1737 uup-A, - HD1745 gyrA,parC, - HD1748 HD1746 HD1739 rpS15, - HD1738 HD1747 hemX, - HD1742 ygdL, - HD1744 hemY, - HD1740 hemX, - HD1741 ppiD, - HD1737 uup-A, - HD1745 gyrA,parC, - HD1748 HD1746 HD1739 rpS15, - HD1738 HD1747 hemX, - HD1742 ygdL, - HD1744 hemY, - HD1740 hemX, - HD1741 ppiD, - HD1737 uup-A, - HD1745 gyrA,parC, - HD1748 HD1746 rpS15, - HD1738 HD1739
* Calculated from Protein Sequence

Gene ID: HD1742

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
hemX  

Definition:
uroporphyrinogen III synthase

Gene Start:
1455236

Gene Stop:
1454481

Gene Length:
756

Molecular Weight*:
28400

pI*:
5.40

Net Charge*:
-5.03

EC:
4.2.1.75  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Heme, porphyrin, and cobalamin  

Pathway: pathway table
Porphyrin and chlorophyll metabolism

Secondary Evidence:
Johansson P, Hederstedt L.
Organization of genes for tetrapyrrole biosynthesis in gram--positive bacteria.
Microbiology. 1999 Mar;145 ( Pt 3):529-38.
PMID: 10217486

Schroder I, Johansson P, Rutberg L, Hederstedt L.
The hemX gene of the Bacillus subtilis hemAXCDBL operon encodes a membrane protein, negatively affecting the steady-state
cellular concentration of HemA (glutamyl-tRNA reductase).
Microbiology. 1994 Apr;140 ( Pt 4):731-40.
PMID: 8012594

Comment:


Blast Summary:  PSI-Blast Search
Residues 1-245 are 37% similar to >15603678 HemX [Pasteurella multocida].

Otherwise, four significant hits in gapped BLAST to uroporphyrinogen-III synthase protein; e.g. positions 1 to 243 are 26% (EScore: 4e-12) similar to gb|AAF33454.1| (AF233324) 83% identity with E. coli uroporphyrinogen-III synthase between positions 1 and 245 in Salmonella typhimurium LT2. Positions 1-243 are 24% (Evalue: 2e-10) similar to (M17360) uroporphyrinogen-III cosynthetase in Escherichia coli, positions 1-243 are 24% (EScore: 2e-10) to (AE000456) uroporphyrinogen III synthase in Escherichia coli.


COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-187 are 37% similar to a (SYNTHASE UROPORPHYRINOGEN-III PROTEOME) protein domain (PD016936) which is seen in Q9CK23_PASMU.



Paralogs:  Local Blast Search
HD1742 is paralogously related to HD0269 (7e-05).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MNVLITYPASRAQKLVDMCQQHRIFAIYQPIFSVELGADLLDLPSAMSRL
NAGDNVIILSKEAFDFAWQTLADTGFAYRADLNYFVADKYLAAYVTAKTT
RPVHYPDTEQCNQLLQLGKLLQLTDKKVLILCAEEQRGLFQNQLAEAKQV
QYLACYYHKHIEQLTAQLSLAKRAGIDTILIENEDVLLTLYEQIAAEDCQ
WLVKTRLVVISQHIANIAEKLGWQSDQVIIAGQTDNQTLLNTMLTFINKA
N$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATGTATTAATTACTTATCCGGCTTCGCGGGCACAAAAGTTAGTAGA
CATGTGTCAACAACACCGTATTTTTGCTATTTATCAGCCAATATTCAGTG
TTGAATTAGGCGCGGATTTACTTGATTTGCCGTCAGCAATGTCTCGTTTA
AATGCGGGAGATAATGTTATTATTTTATCAAAAGAAGCCTTTGATTTTGC
TTGGCAGACATTAGCGGATACCGGCTTTGCTTATCGCGCAGATTTAAATT
ATTTTGTCGCCGATAAATATCTTGCAGCTTATGTGACAGCCAAGACAACA
CGGCCCGTGCATTATCCTGATACTGAACAGTGCAATCAGTTATTGCAATT
GGGTAAATTGCTACAGTTAACCGATAAAAAAGTATTAATTCTTTGTGCTG
AAGAGCAACGAGGTTTATTTCAAAATCAGCTCGCAGAGGCTAAACAAGTT
CAGTATTTAGCCTGTTATTATCATAAACATATCGAACAACTGACGGCACA
GTTAAGCTTAGCTAAGCGGGCAGGAATTGATACAATTTTGATTGAAAATG
AAGATGTTTTATTGACTTTATATGAACAAATAGCTGCAGAGGACTGTCAG
TGGTTAGTGAAAACGCGTTTAGTTGTTATAAGTCAGCATATTGCAAATAT
TGCTGAAAAACTCGGATGGCAGTCTGATCAAGTGATTATTGCAGGACAAA
CGGATAATCAAACTCTGTTAAATACAATGTTAACATTTATCAATAAAGCT
AACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy