Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1272 IGR1270 IGR1277 IGR1276 IGR1275 IGR1273 IGR1274 IGR1278 HD1733 ychE, - HD1736 hemX, - HD1742 mrp, - HD1734 hemY, - HD1740 hemX, - HD1741 oppA, - HD1735 ppiD, - HD1737 HD1739 rpS15, - HD1738 nrdB, - HD1732 HD1733 ychE, - HD1736 hemX, - HD1742 mrp, - HD1734 hemY, - HD1740 hemX, - HD1741 oppA, - HD1735 ppiD, - HD1737 HD1739 rpS15, - HD1738 nrdB, - HD1732 HD1733 ychE, - HD1736 hemX, - HD1742 mrp, - HD1734 hemY, - HD1740 hemX, - HD1741 oppA, - HD1735 ppiD, - HD1737 rpS15, - HD1738 nrdB, - HD1732 HD1739
* Calculated from Protein Sequence

Gene ID: HD1737

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ppiD  

Definition:
peptidyl-prolyl cis-trans isomerase D

Gene Start:
1451233

Gene Stop:
1449371

Gene Length:
1863

Molecular Weight*:
69548

pI*:
4.90

Net Charge*:
-19.51

EC:
5.2.1.8  

Functional Class:
Translation; Protein modification and translation factors  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to conserved hypothetical protein e.g. positions 1 to 618 are 40% (EScore : 1e-123 ) similar to sp|P44092|CYPD_HAEIN between positions 2 and 616 in Haemophilus influenzae. Positions 43 to 618 are 39% (EScore : 1e-115 ) similar to pir||B64018 hypothetical protein HI1004 between positions 17 and 588 in Haemophilus influenzae.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0760
COG name: Parvulin-like peptidyl-prolyl isomerase
Functional Class: O
The phylogenetic pattern of COG0760 is ----yQVcEB-HUJ--ol--X
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 513-618 are 37% similar to a (D ROTAMASE ISOMERASE PPIASE) protein domain (PD415041) which is seen in PPID_HAEIN.

Residues 250-355 are 33% similar to a (ROTAMASE ISOMERASE PPIASE PEPTIDYL-PROLYL) protein domain (PD064423) which is seen in YACD_BACSU.

Residues 1-246 are 42% similar to a (ISOMERASE PROTEOME COMPLETE CIS-TRANS) protein domain (PD013665) which is seen in Q9CJM0_PASMU.

Residues 363-511 are 40% similar to a (ISOMERASE CIS-TRANS PEPTIDYL-PROLYL) protein domain (PD023956) which is seen in PPID_HAEIN.

Residues 238-399 are 25% similar to a (PROTEOME COMPLETE BASIC PUTATIVE) protein domain (PD262676) which is seen in Q9X014_THEMA.

Residues 272-353 are 52% similar to a (ISOMERASE PEPTIDYL-PROLYL CIS-TRANS) protein domain (PD002510) which is seen in Q9CJM0_PASMU.

Residues 69-235 are 25% similar to a (COMPLETE ORF MITOCHONDRION PROTEOME) protein domain (PD000146) which is seen in PPID_BUCAI.



Paralogs:  Local Blast Search
HD1737 is paralogously related to HD1180 (3e-10).


Pfam Summary:  Pfam Search
Residues 274 to 357 (E-value = 4.1e-33) place HD1737 in the Rotamase family which is described as PPIC-type PPIASE domain (PF00639)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MIEKMHERTNSVAFKVIFALVSLSFVLTGIGTGLVGADTSAVKVNGTTID
QHAFNTAKARQQNVLNAQLGERFWDLLDTPEYAKQFNQSVLDGLVNDELM
RQYAKDLKLGISANQIKSQIVNSQIFQQDGKFNNELYQHTLRNNGLTADG
YAAIVNEGMLLSQIQKGIVESDFSVPVTEALLAKLLLQQRQVRLATYPIA
KEIANQTASVEELQKYYDAKKTDLVEPEQLVVEYVTFMPKDIEKNIQVTD
EQVATYYEKNKADFVTKGETHLAHIQLANEEKAKQVAEALKQGTDFAMLA
NDTSTDSLSAQQGGDLGWTKAGIFPEIFEQTANALAINEVSEPVKVDNNY
HIIKVLDRKEDVALPFEMVKDKIVKIIRDELLLTEYSNISHEMANKAFEN
SSSLAEVAQIAGVNVQTSTQFNREHIPADLNNEKVIKALFNGELRQSGQN
SDALDVGNEREPKTMFVRVRDFYPERVRTFDEAKADIEQIVKHQKAEQLL
LAKAEENVKALNEGNAVNVDFNEAETLVYAKRADNPILFKTVFAMQKPTD
KPTYQVTHNQQGDVVIVSLEKVIDGKQEEFAPLASQLKQLDQTLLRNDLL
KDLRSRASVDVNQNFIEQLK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTGAAAAAATGCATGAGCGAACTAATAGTGTTGCTTTTAAAGTTAT
TTTTGCGTTAGTTTCTTTATCATTTGTGCTGACAGGGATTGGAACGGGGT
TGGTCGGTGCAGATACGTCGGCGGTCAAAGTAAATGGTACAACCATTGAT
CAACACGCGTTTAATACGGCAAAAGCACGTCAGCAGAATGTGTTAAATGC
TCAATTAGGTGAACGTTTTTGGGATTTATTAGATACGCCAGAATATGCTA
AGCAATTTAATCAATCAGTATTAGACGGTTTAGTCAATGATGAATTAATG
CGTCAATATGCAAAAGATCTAAAATTAGGCATTAGTGCTAATCAGATCAA
ATCCCAAATTGTCAATAGCCAAATATTCCAACAAGATGGCAAATTTAATA
ATGAACTTTATCAACATACGTTACGTAACAATGGTCTAACTGCTGATGGC
TATGCGGCAATAGTGAATGAGGGAATGTTATTATCACAAATTCAAAAAGG
TATTGTGGAGAGTGATTTTAGTGTGCCAGTAACAGAAGCGTTACTTGCTA
AATTATTATTACAACAACGCCAAGTTCGCTTAGCCACTTATCCAATTGCA
AAAGAAATAGCAAATCAAACCGCTTCAGTTGAGGAATTGCAAAAATACTA
CGACGCTAAGAAAACAGATTTAGTTGAGCCAGAACAATTAGTCGTTGAAT
ATGTGACTTTTATGCCGAAAGATATCGAAAAAAACATTCAGGTAACAGAT
GAACAAGTTGCAACTTATTATGAAAAAAATAAAGCAGATTTTGTTACTAA
AGGCGAAACCCATTTAGCGCATATTCAATTAGCAAATGAAGAAAAGGCTA
AGCAAGTTGCAGAAGCGCTTAAACAAGGAACAGATTTTGCTATGTTAGCC
AATGATACATCAACCGATTCTTTATCTGCACAACAAGGTGGAGATTTAGG
TTGGACAAAAGCGGGCATTTTCCCCGAAATTTTTGAACAAACGGCTAATG
CTTTAGCAATTAATGAGGTAAGTGAACCTGTTAAAGTAGATAATAATTAT
CATATTATTAAAGTTTTAGATCGTAAAGAAGATGTGGCTTTACCATTTGA
AATGGTTAAAGATAAGATTGTGAAAATCATTCGTGATGAATTATTGTTGA
CTGAATATTCTAATATTAGTCATGAAATGGCGAATAAAGCCTTTGAGAAT
AGTAGTTCATTAGCAGAAGTGGCACAAATAGCAGGTGTTAATGTACAAAC
ATCAACACAATTTAACCGCGAACATATTCCGGCGGATTTAAATAATGAAA
AAGTGATTAAAGCACTATTTAATGGTGAGTTACGTCAATCAGGTCAGAAT
TCTGATGCGCTTGATGTAGGTAATGAACGCGAGCCTAAAACGATGTTTGT
ACGTGTCAGAGATTTTTATCCAGAACGTGTAAGAACATTTGATGAAGCTA
AAGCGGATATAGAACAAATAGTTAAACATCAAAAAGCAGAACAGTTATTA
TTAGCTAAAGCAGAAGAAAATGTAAAAGCTTTAAATGAAGGGAACGCAGT
TAATGTTGATTTTAATGAAGCAGAAACCTTAGTGTATGCTAAAAGAGCGG
ATAATCCAATCTTATTTAAAACAGTCTTTGCAATGCAAAAACCGACAGAT
AAACCGACTTATCAAGTGACACATAATCAGCAAGGAGATGTTGTGATTGT
GAGTTTAGAGAAAGTGATCGATGGTAAACAAGAAGAATTTGCTCCGCTAG
CAAGTCAATTAAAGCAACTAGATCAGACATTATTACGTAATGACTTACTA
AAAGATCTACGTTCTAGAGCATCAGTTGATGTGAATCAAAACTTTATTGA
GCAACTTAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy