Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1272 IGR1270 IGR1267 IGR1266 IGR1273 IGR1268 IGR1269 HD1730 HD1733 ychE, - HD1736 mrp, - HD1734 oppA, - HD1735 ppiD, - HD1737 dsbB, - HD1729 nrdB, - HD1732 nhaB, - HD1728 nrdA, - HD1731 HD1730 HD1733 ychE, - HD1736 mrp, - HD1734 oppA, - HD1735 ppiD, - HD1737 dsbB, - HD1729 nrdB, - HD1732 nhaB, - HD1728 nrdA, - HD1731 HD1730 HD1733 ychE, - HD1736 mrp, - HD1734 oppA, - HD1735 ppiD, - HD1737 dsbB, - HD1729 nrdB, - HD1732 nhaB, - HD1728 nrdA, - HD1731
* Calculated from Protein Sequence

Gene ID: HD1732

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
nrdB  

Definition:
ribonucleoside-diphosphate reductase beta chain (small subunit)

Gene Start:
1444739

Gene Stop:
1445869

Gene Length:
1131

Molecular Weight*:
43570

pI*:
4.40

Net Charge*:
-22.99

EC:
1.17.4.1  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; 2'-Deoxyribonucleotide metabolism  

Pathway: pathway table
Purine metabolism
Pyrimidine metabolism

Secondary Evidence:
Guzman EC, Caballero JL, Jimenez-Sanchez A.
Ribonucleoside diphosphate reductase is a component of the replication hyperstructure in Escherichia coli.
Mol Microbiol. 2002 Jan;43(2):487-95.
PMID: 11985724

Gallardo-Madueno R, Leal JF, Dorado G, Holmgren A, Lopez-Barea J, Pueyo C.
In vivo transcription of nrdAB operon and of grxA and fpg genes is triggered in Escherichia coli lacking both thioredoxin and
glutaredoxin 1 or thioredoxin and glutathione, respectively.
J Biol Chem. 1998 Jul 17;273(29):18382-8.
PMID: 9660805

Comment:
0

Blast Summary:  PSI-Blast Search
Numerous signficant hits in gapped BLAST to ribonucleoside-diphosphate reductase protein; i.e. residues 1-376 are 91% similar to (U32839) ribonucleoside diphosphate reductase, beta chain of Haemophilus influenzae, residues 1-376 are 82% similar to (D90855) ribonucleoside-diphosphate reductase in E.coli, residues 1-376 are 81% similar to (X72948) ribonucleoside diphosphate reductase, beta chain of Salmonella typhimurium.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0208
COG name: Ribonucleotide reductase beta subunit
Functional Class:  F
The phylogenetic pattern of COG0208 is ----YQ-cEBRhujgp-linx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000358 (Ribonucleotide reductase) with a combined E-value of 4.5e-43.
    IPB000358A    33-87
    IPB000358B    108-133
    IPB000358C    211-251
    IPB000358D    279-289
    IPB000358E    347-357


ProDom Summary:  Protein Domain Search
Residues 33-89 are 82% similar to a (REDUCTASE RIBONUCLEOTIDE SMALL CHAIN) protein domain (PD002465) which is seen in RIR2_BUCAI.

Residues 116-362 are 23% similar to a (REDUCTASE RIBONUCLEOTIDE SMALL CHAIN) protein domain (PD000938) which is seen in RIR2_HELPJ.

Residues 92-174 are 77% similar to a (REDUCTASE RIBONUCLEOSIDE-DIPHOSPHATE BETA) protein domain (PD407064) which is seen in RIR2_ECOLI.

Residues 1-32 are identical to a (REDUCTASE BETA RIBONUCLEOSIDE-DIPHOSPHATE) protein domain (PD013746) which is seen in Q9CMT9_PASMU.

Residues 33-91 are 98% similar to a (REDUCTASE BETA RIBONUCLEOSIDE-DIPHOSPHATE) protein domain (PD359132) which is seen in Q9CMT9_PASMU.

Residues 92-357 are 89% similar to a (REDUCTASE BETA CHAIN RIBONUCLEOTIDE) protein domain (PD219999) which is seen in Q9CMT9_PASMU.



Paralogs:  Local Blast Search
HD1732 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 16 to 339 (E-value = 1.2e-137) place HD1732 in the Ribonuc_red_sm family which is described as Ribonucleotide reductase, small chain (PF00268)

PDB Hit:
pdb|1XIK|B Chain B, Ribonucleoside-Diphosphate Reductase 1 Beta... 639 0.0
pdb|1BIQ|B Chain B, Ribonucleoside-Diphosphate Reductase 1 Beta... 635 0.0
pdb|1RIB|A Chain A, Protein R2 Of Ribonucleotide Reductase (E.C... 634 0.0

Gene Protein Sequence:
MAYTTFSQNKNDQLKEPMFFGQNVNVARYDQQKYELFEKLIEKQLSFFWR
PEEVDVSQDRIDYQALPEHEKHIFISNLKYQTLLDSIQGRSPNVAFLPLV
SIPELETWIETWTFSETIHSRSYTHIIRNIVNDPSIVFDDIVTNEEIIKR
ARDISCYYDDLIRDSQLYTLYGEGTYQVDGKACAVTLRNLKRQLYLCLMS
VNVLEAIRFYVSFACSFAFAERQLMEGNAKIIKFIARDEYLHLAGTQQML
NIIASGQDDPEMAEIAIECQQEAYDLFVAAAEQEKEWAEYLFKDGSMIGL
NKEILVKYVEYITNIRMQSVGLPLPFATQSNPIPWINAWLVSDNVQVAPQ
EVEVSSYLVGQIDSKVDSNDFDNFEL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTTATACCACTTTCTCACAAAATAAAAATGATCAATTAAAAGAACC
TATGTTCTTTGGTCAAAACGTGAATGTTGCTCGTTATGACCAACAAAAAT
ATGAATTATTTGAAAAATTAATTGAAAAACAACTTTCATTTTTCTGGCGT
CCTGAAGAAGTTGATGTATCTCAAGATCGCATTGACTATCAAGCATTGCC
TGAACATGAAAAACATATTTTTATTAGTAATTTAAAGTACCAAACGCTAT
TAGATTCTATTCAAGGCCGAAGCCCCAATGTCGCTTTTTTGCCGCTTGTT
TCTATTCCAGAATTAGAAACATGGATTGAAACTTGGACGTTTTCTGAGAC
TATTCACTCACGTTCTTATACTCATATTATTCGTAATATTGTTAATGATC
CTTCCATTGTATTTGATGATATTGTCACCAATGAAGAAATCATTAAGCGT
GCTAGGGATATCTCTTGTTATTATGATGATTTAATTCGTGATTCACAACT
TTATACCCTCTATGGTGAAGGTACTTATCAAGTTGATGGTAAAGCGTGTG
CAGTTACATTACGTAATTTAAAACGCCAACTTTATCTCTGTTTAATGAGC
GTCAACGTATTAGAAGCGATTCGTTTTTACGTATCATTTGCCTGTTCATT
TGCCTTTGCTGAACGCCAATTAATGGAAGGCAATGCAAAAATTATTAAAT
TCATCGCACGCGATGAATATCTACACCTAGCAGGTACTCAGCAAATGTTA
AATATTATTGCATCAGGTCAAGATGATCCTGAGATGGCAGAAATTGCGAT
TGAATGTCAGCAAGAAGCTTATGATTTATTTGTTGCTGCTGCTGAACAAG
AAAAAGAGTGGGCAGAATATCTGTTTAAAGATGGTTCAATGATTGGTTTA
AATAAAGAAATTTTAGTTAAATATGTCGAATATATCACCAATATTCGTAT
GCAATCGGTCGGATTACCCTTGCCTTTCGCCACCCAGTCGAACCCTATCC
CTTGGATTAACGCATGGTTAGTCTCTGATAATGTACAAGTCGCTCCACAA
GAAGTAGAGGTAAGCTCTTATTTAGTTGGACAAATTGATTCAAAAGTTGA
CAGCAATGACTTTGATAATTTCGAACTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy