Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1270 IGR1264 IGR1263 IGR1267 IGR1266 IGR1262 IGR1268 IGR1269 IGR1265 HD1730 HD1733 phoH,psiH, - HD1724 phoH,psiH, - HD1726 fadR, - HD1727 mrp, - HD1734 dsbB, - HD1729 nrdB, - HD1732 nhaB, - HD1728 tktA, - HD1723 nrdA, - HD1731 HD1730 HD1733 phoH,psiH, - HD1724 phoH,psiH, - HD1726 fadR, - HD1727 mrp, - HD1734 dsbB, - HD1729 nrdB, - HD1732 nhaB, - HD1728 tktA, - HD1723 nrdA, - HD1731 HD1730 HD1733 phoH,psiH, - HD1724 phoH,psiH, - HD1726 fadR, - HD1727 mrp, - HD1734 dsbB, - HD1729 nrdB, - HD1732 nhaB, - HD1728 tktA, - HD1723 nrdA, - HD1731
* Calculated from Protein Sequence

Gene ID: HD1729

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
dsbB  

Definition:
disulfide bond formation protein B (disulfide oxidoreductase)

Gene Start:
1441448

Gene Stop:
1441987

Gene Length:
540

Molecular Weight*:
20821

pI*:
9.40

Net Charge*:
6.23

EC:
1.8.4.-  

Functional Class:
Translation; Protein modification and translation factors  

Pathway: pathway table

Secondary Evidence:
Missiakas,D., Georgopoulos,C. and Raina,S.
Identification and characterization of the Escherichia coli gene
dsbB, whose product is involved in the formation of disulfide bonds in vivo
Proc. Natl. Acad. Sci. U.S.A. 90 (15), 7084-7088 (1993)
Medline: 93348217


Comment:
For other "dsb" genes, see HD0807 (dsbD), HD0638 (dsbA), HD0616 (dsbE), HD1340 (dsbC).

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to disulfide bond formation protein B; i.e. residues 1-178 are 44% similar to (AF237925) disulfide bond formation protein B of Pasteurella multocida, residues 1-175 are 40% similar to (U32726) disulfide bond formation protein B of Haemophilus influenzae, residues 1-171 are 37% similar to (D90752) Disulfide bond formation protein of E.coli.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
***** IPB003752 (Disulfide bond formation protein DsbB) with a combined E-value of 6e-16.
    IPB003752    29-61


ProDom Summary:  Protein Domain Search
Residues 1-74 are 43% similar to a (DISULFIDE OXIDOREDUCTASE CENTER MEMBRANE) protein domain (PD020096) which is seen in DSBB_PASMU.

Residues 75-139 are 52% similar to a (DISULFIDE OXIDOREDUCTASE TRANSMEMBRANE) protein domain (PD015376) which is seen in DSBB_HAEIN.



Paralogs:  Local Blast Search
HD1729 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 5 to 166 (E-value = 4e-48) place HD1729 in the DsbB family which is described as Disulfide bond formation protein DsbB (PF02600)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MLSYFKELSLRRPAWLLLATLACTLEVTGLYFQHKLGLIPCVMCIYERVA
LTGLLIAGLIALIAPNFFLFRWLALVLWGFSAFKGLSLSIKHYDYQANPS
PWNQCEFKPQFPQTIPLDEWFPNIFAAGTVNCSEKQWQMLGWGMPEWLIV
AFSLFMLFFLIVFMSQFKRAKPQYRSVFR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTCAGCTATTTCAAAGAACTATCGTTACGTAGACCCGCTTGGTTATT
ACTTGCAACTTTAGCCTGTACCCTTGAAGTAACTGGTCTTTATTTCCAAC
ATAAATTAGGCCTAATTCCGTGTGTTATGTGTATATATGAACGCGTTGCA
CTTACTGGTTTATTAATTGCTGGCTTAATTGCCTTAATTGCACCTAATTT
CTTCCTATTCCGCTGGCTAGCGCTAGTATTATGGGGTTTCAGTGCATTTA
AAGGTTTATCACTTTCTATTAAACATTATGATTATCAAGCCAATCCATCG
CCTTGGAATCAATGTGAGTTTAAACCACAATTCCCACAAACAATACCGCT
TGATGAATGGTTTCCCAATATTTTTGCTGCTGGTACGGTCAATTGTAGTG
AAAAGCAATGGCAAATGTTAGGCTGGGGGATGCCAGAATGGTTAATTGTC
GCCTTTAGTTTATTTATGCTATTTTTCTTAATTGTCTTTATGAGTCAATT
TAAACGCGCTAAGCCACAATATCGCTCAGTATTTAGATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy