Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1264 IGR1258 IGR1257 IGR1263 IGR1260 IGR1266 IGR1262 IGR1265 IGR1261 rpL31,rpmE, - HD1722 phoH,psiH, - HD1724 phoH,psiH, - HD1726 lbgA,losA, - HD1721 fadR, - HD1727 lbgB,losB, - HD1720 dsbB, - HD1729 xthA, - HD1718 HD1717 nhaB, - HD1728 tktA, - HD1723 rpL31,rpmE, - HD1722 phoH,psiH, - HD1724 phoH,psiH, - HD1726 lbgA,losA, - HD1721 fadR, - HD1727 lbgB,losB, - HD1720 dsbB, - HD1729 xthA, - HD1718 HD1717 nhaB, - HD1728 tktA, - HD1723 rpL31,rpmE, - HD1722 phoH,psiH, - HD1724 phoH,psiH, - HD1726 lbgA,losA, - HD1721 fadR, - HD1727 lbgB,losB, - HD1720 dsbB, - HD1729 xthA, - HD1718 HD1717 nhaB, - HD1728 tktA, - HD1723
* Calculated from Protein Sequence

Gene ID: HD1723

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
tktA  

Definition:
transketolase isozyme 1

Gene Start:
1435762

Gene Stop:
1437759

Gene Length:
1998

Molecular Weight*:
73141

pI*:
6.10

Net Charge*:
-10.41

EC:
2.2.1.1  

Functional Class:
Energy metabolism; Pentose phosphate pathway  

Pathway: pathway table
Carbon fixation
Pentose phosphate cycle

Secondary Evidence:
Katayama A, Tsujii A, Wada A, Nishino T, Ishihama A.
Systematic search for zinc-binding proteins in Escherichia coli.
Eur J Biochem. 2002 May;269(9):2403-13.
PMID: 11985624

Tatarko M, Romeo T.
Disruption of a global regulatory gene to enhance central carbon flux into phenylalanine biosynthesis in Escherichia coli.
Curr Microbiol. 2001 Jul;43(1):26-32.
PMID: 11375660

Sprenger GA, Schorken U, Sprenger G, Sahm H.
Transketolase A of Escherichia coli K12. Purification and properties of the enzyme from recombinant strains.
Eur J Biochem. 1995 Jun 1;230(2):525-32.
PMID: 7607225

Zhao G, Winkler ME.
An Escherichia coli K-12 tktA tktB mutant deficient in transketolase activity requires pyridoxine (vitamin B6) as well as the aromatic amino acids and
vitamins for growth.
J Bacteriol. 1994 Oct;176(19):6134-8.
PMID: 7928977

Comment:
A second isozyme, tktB, was not found in this genome.

Blast Summary:  PSI-Blast Search
Numerous significant hit to gapped BLAST to transketolase protein; i.e. residues 1-664 are 84% similar to (U32783) transketolase 1 of Haemophilus influenzae, residues 1-664 are 75% similar to (AE000376) transketolase 1 isozyme of E.coli, residues 7-664 are 64% similar to (AL162756) transketolase of Neisseria meningitidis.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0021
COG name: Transketolase
Functional Class:  G
The phylogenetic pattern of COG0021 is -m--YqVCEbrhujgp-lin-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000360 (Transketolase) with a combined E-value of 3.1e-50.
    IPB000360A    25-36
    IPB000360B    38-77
    IPB000360C    468-497


ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search


HD1723 is paralogously related to HD1625 (3e-07) and HD0441 (9e-05).


Pfam Summary:  Pfam Search
Residues 3 to 334 (E-value = 9.6e-243) place HD1723 in the Transketolase_N family which is described as Transketolase, thiamine diphosphate binding domain (PF00456)
Residues 355 to 527 (E-value = 8.3e-66) place HD1723 in the Transket_pyr family which is described as Transketolase, pyridine binding domain (PF02779)
Residues 542 to 657 (E-value = 1.7e-14) place HD1723 in the Transketolase_C family which is described as Transketolase, C-terminal domain (PF02780)

PDB Hit:
pdb|1TKB|A Chain A, Transketolase (E.C.2.2.1.1) Complexed With ... 599 4e-172
pdb|1TRK|A Chain A, Transketolase (E.C.2.2.1.1) >gi|515260|pdb|... 599 4e-172
pdb|1AY0|A Chain A, Identification Of Catalytically Important R... 595 6e-171

Gene Protein Sequence:
MTERKVLANAIRFLSMDAVQKANSGHPGAPMGMADIAEVLWRDFLKHNPT
NPKWADRDRFVLSNGHGSMLIYSLLHLSGYDLSIEDLKQFRQLHSKTPGH
PEYGYAPGVETTTGPLGQGITNAVGMAIAEKTLAAQFNREGHKIVDHYTY
AFLGDGCLMEGISHEACSLAGTLGLGKLIAFYDDNNISIDGHVDGWFADD
TAQRFEAYGWQVIRNVDGHDATQIKIAIENAQAEKDRPTLIICKTIIGYG
SPNKSASHDCHGAPLGNGEIALTRQALNWQYAPFEIPADIYADWDAKAKG
CLIEKEWDAKFVAYQTAYPALAAEFKRRMAGDLPANWKTEASHFIETLQA
NPASIASRKASQNAIEAYAHLLPELLGGSADLASSNLTLWSGSKPIRADH
NVDGNYINYGVREFGMSAIMNGIALHGGFIPYGATFLMFYEYAHNAVRMA
ALMKQRALFVYTHDSIGLGEDGPTHQPVEQTASLRYIPNLETWRPCDQVE
SAIAWKSAIERQDGPTALIFTRQNLAQQARMAEQLANVARGGYVLKEASG
TPDLILIATGSEVELAIKAAEVLENEGKKVRVVSMPSTNIFDKQSEAYRE
SVLPRAITKRIAIEAQLSDFWYKYVGFEGRIIGMNSFGESAPADQLFKLF
GFSVENVVAKAKEMW$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAGAACGTAAAGTGCTCGCGAATGCAATTCGTTTTTTAAGTATGGA
TGCAGTACAAAAAGCTAATTCAGGCCACCCCGGTGCGCCGATGGGAATGG
CTGATATTGCTGAAGTATTATGGCGTGATTTCTTGAAGCATAATCCGACT
AATCCTAAATGGGCAGATCGCGACCGCTTTGTGCTCTCCAACGGTCATGG
CTCCATGTTAATTTATAGTTTATTGCATTTGAGCGGTTATGATCTTTCAA
TTGAAGATTTAAAACAATTCCGTCAATTGCACTCTAAAACACCTGGACAT
CCTGAATATGGTTATGCACCCGGTGTAGAAACAACGACCGGTCCGTTAGG
TCAAGGTATTACTAATGCGGTAGGAATGGCCATTGCTGAAAAAACATTAG
CGGCTCAATTTAACCGTGAAGGCCACAAAATTGTTGATCATTATACTTAT
GCCTTTTTAGGTGATGGCTGTCTAATGGAAGGTATTTCACATGAAGCTTG
TTCATTAGCGGGCACATTAGGTTTAGGTAAACTAATTGCTTTTTATGATG
ATAATAATATTTCTATCGATGGCCATGTAGATGGTTGGTTTGCTGATGAT
ACTGCACAACGTTTTGAAGCCTATGGTTGGCAAGTGATTCGGAATGTAGA
TGGACACGATGCAACCCAAATCAAAATAGCGATTGAAAATGCACAAGCGG
AAAAAGATCGCCCAACGTTAATTATCTGTAAAACAATTATTGGTTATGGT
TCACCAAACAAATCTGCATCACACGATTGCCACGGTGCTCCATTAGGTAA
TGGGGAGATTGCATTAACTCGCCAAGCATTAAATTGGCAATATGCGCCAT
TCGAAATTCCTGCGGATATCTATGCAGACTGGGATGCTAAGGCAAAAGGT
TGCTTAATCGAAAAAGAATGGGATGCAAAATTTGTTGCTTATCAGACCGC
TTATCCAGCGCTTGCTGCTGAATTTAAACGCCGTATGGCGGGTGATTTAC
CGGCAAATTGGAAAACAGAAGCCAGTCACTTTATTGAAACATTACAAGCT
AATCCTGCTTCAATTGCAAGCCGTAAAGCATCACAAAATGCGATCGAAGC
TTATGCACATTTATTGCCTGAACTTTTAGGTGGCTCTGCAGATTTAGCCA
GTTCAAACTTAACGCTTTGGTCTGGTTCAAAACCAATTCGTGCGGATCAT
AATGTTGATGGGAATTATATCAATTATGGGGTTCGTGAATTCGGTATGTC
TGCCATTATGAATGGTATTGCGTTGCACGGTGGTTTTATCCCTTATGGTG
CGACTTTCTTGATGTTCTATGAATATGCACATAATGCTGTACGTATGGCA
GCATTAATGAAACAACGTGCCTTATTTGTTTATACCCATGATTCTATCGG
TTTAGGAGAAGATGGTCCAACGCATCAACCCGTAGAACAGACCGCTTCAT
TACGTTACATTCCAAATTTAGAAACGTGGCGCCCTTGTGACCAAGTTGAA
TCAGCCATTGCGTGGAAATCCGCTATTGAACGTCAAGATGGGCCAACTGC
ATTGATCTTTACACGGCAAAATTTAGCACAGCAGGCGCGTATGGCAGAAC
AATTAGCGAATGTTGCTCGTGGCGGTTATGTATTGAAAGAGGCATCTGGC
ACTCCAGATTTAATCTTAATTGCGACAGGATCTGAAGTCGAACTTGCAAT
TAAAGCCGCTGAAGTGCTTGAAAATGAAGGTAAAAAAGTACGCGTAGTGT
CGATGCCATCAACGAATATTTTCGATAAACAAAGCGAAGCTTATCGTGAG
TCAGTGTTACCTCGCGCTATCACCAAACGCATAGCGATTGAAGCACAATT
ATCTGATTTCTGGTACAAATACGTTGGCTTTGAAGGCCGTATTATCGGTA
TGAATAGTTTTGGTGAATCAGCACCTGCAGATCAATTATTCAAATTATTT
GGTTTTAGCGTGGAAAACGTGGTGGCCAAAGCAAAAGAAATGTGGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy