Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1253 IGR1258 IGR1257 IGR1255 IGR1260 IGR1262 IGR1256 IGR1261 rpL31,rpmE, - HD1722 phoH,psiH, - HD1724 ispA, - HD1712 lbgA,losA, - HD1721 HD1713 lbgB,losB, - HD1720 HD1715 xthA, - HD1718 HD1716 HD1717 tktA, - HD1723 rpL31,rpmE, - HD1722 phoH,psiH, - HD1724 ispA, - HD1712 lbgA,losA, - HD1721 HD1713 lbgB,losB, - HD1720 HD1715 xthA, - HD1718 HD1716 HD1717 tktA, - HD1723 rpL31,rpmE, - HD1722 phoH,psiH, - HD1724 ispA, - HD1712 lbgA,losA, - HD1721 HD1713 lbgB,losB, - HD1720 coA,yciA, - HD1711 coA,yciA, - HD1711 xthA, - HD1718 HD1716 HD1717 tktA, - HD1723 HD1714 HD1715 HD1714
* Calculated from Protein Sequence

Gene ID: HD1718

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
xthA  

Definition:
exonuclease III

Gene Start:
1432565

Gene Stop:
1433368

Gene Length:
804

Molecular Weight*:
30777

pI*:
7.00

Net Charge*:
0.00

EC:
3.1.11.2  

Functional Class:
Other categories; Radiation sensitivity  
Replication; Degradation of DNA  

Pathway: pathway table

Primary Evidence:
Stevens,M.K., Klesney-Tait,J., Lumbley,S., Walters,K.A.,
Joffe,A.M., Radolf,J.D. and Hansen,E.J.
Identification of tandem genes involved in lipooligosaccharide
expression by Haemophilus ducreyi
Infect. Immun. 65 (2), 651-660 (1997)
Medline: 97162340


Secondary Evidence:
Saporito,S.M., Smith-White,B.J. and Cunningham,R.P.
Nucleotide sequence of the xth gene of Escherichia coli K-12
J. Bacteriol. 170 (10), 4542-4547 (1988)
Medline: 89008066

Serafini DM, Schellhorn HE.
Endonuclease III and endonuclease IV protect Escherichia coli from the lethal and mutagenic effects of near-UV irradiation.
Can J Microbiol. 1999 Jul;45(7):632-7.
PMID: 10497792


Comment:
From Genbank:[gi:1169570]
This enzyme is a major apurinic-apyrimidinic endonuclease of E.coli. It removes the damaged DNA at cytosines and guanines by cleaving on the 3' side of the AP site by a beta-elimination reaction.



Blast Summary:  PSI-Blast Search
A match in gapped BLAST to a previously submitted sequence in Genbank: residues 1-267 are identical to exonuclease III from Haemophilus ducreyi (1388153|).
Residues 1-267 are 75% similar to exodeoxyribonuclease III (exonuclease III) from Haemophilus influenzae (1169570|).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0708
COG name: Exonuclease III
Functional Class: L
The phylogenetic pattern of COG0708 is a-t-y--cebrhuj--ol--X
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000097 (AP endonucleases family 1) with a combined E-value of 4.8e-68.
    IPB000097A    1-13
    IPB000097B    27-36
    IPB000097C    59-96
    IPB000097D    144-178
    IPB000097E    210-257


ProDom Summary:  Protein Domain Search
Residues 8-262 are identical to a (ENDONUCLEASE EXODEOXYRIBONUCLEASE) protein domain (PD002469) which is seen in Q47962_HAEDU.



Paralogs:  Local Blast Search
HD1718 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 266 (E-value = 1.5e-55) place HD1718 in the Exo_endo_phos family which is described as Endonuclease/Exonuclease/phosphatase family (PF03372)

PDB Hit:
pdb|1AKO| Exonuclease Iii From Escherichia Coli 420 1e-118
pdb|1DEW|B Chain B, Crystal Structure Of Human Ape1 Bound To Ab... 94 3e-020
pdb|1DE8|A Chain A, Human ApurinicAPYRIMIDINIC ENDONUCLEASE-1 (... 94 3e-020

Gene Protein Sequence:
MKFISFNINGLRARPHQLEAIINKHQPDVIGLQEIKVADEDFPHQLVEHL
GYHVFYHGQKGHYGVALLTKKQPLTIRKGFPNDTADAQKRMIMAEINTDF
GILTVLNGYFPQGENRQHETKFPAKAKFYADLQHYLETALTAYNPIIIMG
DMNICSTDLDIGIGEANRKRWLREGKCSFLPEEREWLDRLYHYGLVDTFR
AMHPTTTDQFSWFDYRSKGFNDNRGLRIDLILASTTLANHCVETGIDLEI
RAMEKPSDHAPIWAVFK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGTTTATCTCTTTTAATATCAATGGCTTACGTGCTAGACCACATCA
ATTAGAAGCAATCATCAATAAACATCAGCCTGATGTGATCGGCTTACAAG
AAATCAAAGTTGCAGATGAAGATTTCCCACATCAACTTGTAGAACATCTG
GGCTATCACGTTTTTTATCATGGCCAAAAAGGCCATTATGGCGTAGCACT
TTTAACTAAAAAACAACCGCTTACCATTCGTAAAGGCTTTCCAAATGATA
CAGCTGATGCCCAAAAGCGAATGATTATGGCAGAGATTAACACTGATTTT
GGTATCCTAACCGTACTAAATGGCTACTTCCCACAAGGTGAAAATCGCCA
GCATGAAACAAAATTTCCTGCTAAAGCAAAATTCTATGCTGACCTACAAC
ATTATTTAGAAACCGCCCTAACAGCATACAACCCTATTATTATTATGGGT
GATATGAATATCTGCTCTACGGATTTAGATATTGGGATTGGTGAAGCAAA
TCGTAAACGTTGGCTAAGAGAAGGCAAATGTTCTTTCTTACCAGAAGAAC
GCGAATGGTTAGACCGTTTATATCACTATGGTTTAGTAGATACTTTCCGT
GCAATGCATCCAACTACAACTGATCAATTCTCATGGTTTGATTATCGCTC
TAAAGGTTTTAATGACAACCGTGGGTTACGAATTGACTTAATTTTAGCTT
CAACAACACTAGCAAACCATTGTGTAGAAACAGGAATTGATTTAGAAATC
AGAGCTATGGAAAAACCCTCTGATCATGCCCCTATTTGGGCAGTATTTAA
ATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy