Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1253 IGR1247 IGR1252 IGR1255 IGR1251 IGR1249 IGR1246 IGR1250 IGR1248 HD1710 HD1708 HD1705 ispA, - HD1712 HD1706 HD1713 imp, - HD1704 glnE, - HD1709 HD1715 HD1716 gltS, - HD1707 HD1710 HD1708 HD1705 ispA, - HD1712 HD1706 HD1713 imp, - HD1704 glnE, - HD1709 HD1715 HD1716 gltS, - HD1707 HD1708 ispA, - HD1712 HD1706 HD1713 imp, - HD1704 glnE, - HD1709 coA,yciA, - HD1711 HD1710 HD1705 coA,yciA, - HD1711 HD1716 gltS, - HD1707 HD1714 HD1715 HD1714
* Calculated from Protein Sequence

Gene ID: HD1709

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
glnE  

Definition:
glutamate-ammonia-ligase adenylyltransferase

Gene Start:
1427160

Gene Stop:
1424287

Gene Length:
2874

Molecular Weight*:
110397

pI*:
7.10

Net Charge*:
1.60

EC:
2.7.7.42  

Functional Class:
Translation; Protein modification and translation factors  

Pathway: pathway table

Secondary Evidence:
van Heeswijk,W.C., Rabenberg,M., Westerhoff,H.V. and Kahn,D.
The genes of the glutamine synthetase adenylylation cascade are not regulated by nitrogen in Escherichia coli
Mol. Microbiol. 9 (3), 443-457 (1993)
Medline: 94018640


Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to glutamate ammonia ligase adenylyl-transferase protein; i.e. residues 21-953 are 55% similar to(U32692) glutamate-ammonia-ligase adenylyltransferase of Haemophilus influenza, residues 11-951 are 50% similar to glutamate ammonia ligase adenylyl-transferase of E.coli, residues 71-953 are 34% similar to(AE002380) glutamate-ammonia-ligase adenylyltransferase of Neisseria meningitidis.

COGS Summary:  COGS Search
BeTs to 3 clades of COG1391
COG name: Glutamine synthetase adenylyltransferase GlnE
Functional Class: O,T
The phylogenetic pattern of COG1391 is -----q--e-rh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 428-617 are 59% similar to a (ADENYLYLTRANSFERASE) protein domain (PD044013) which is seen in Q9FD13_PASHA.

Residues 620-721 are 43% similar to a (GLUTAMATE-AMMONIA-LIGASE) protein domain (PD340734) which is seen in Q9K1D5_NEIMB.

Residues 618-741 are 76% similar to a (ADENYLYLTRANSFERASE) protein domain (PD011929) which is seen in Q9FD13_PASHA.

Residues 743-841 are 71% similar to a (ADENYLYLTRANSFERASE) protein domain (PD008864) which is seen in Q9FD13_PASHA.

Residues 418-875 are 25% similar to a (LIGASE PROTEOME TRANSFERASE) protein domain (PD147866) which is seen in O67651_AQUAE.

Residues 307-398 are 71% similar to a (ADENYLYLTRANSFERASE) protein domain (PD147868) which is seen in Q9FD13_PASHA.

Residues 842-952 are 57% similar to a (ADENYLYLTRANSFERASE) protein domain (PD044012) which is seen in Q9FD13_PASHA.



Paralogs:  Local Blast Search
HD1709 is paralogously related to HD0830 (0.001).


Pfam Summary:  Pfam Search
Residues 71 to 292 (E-value = 1e-126) place HD1709 in the GlnE family which is described as Glutamate-ammonia ligase adenylyltransferase (PF03710)
Residues 620 to 840 (E-value = 8.6e-117) place HD1709 in the GlnE family which is described as Glutamate-ammonia ligase adenylyltransferase (PF03710)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MFSQLDFTGLPLANTGENRPLAIAVAMSNFVKKTLQKQADLRDDWQRKLP
TLADCGNYAERLTIYLSTINDEVQLSHCLRNFRHREMARLSFIQSNKLAT
VEFVFEQLSDLAEAIILAARDWLFTRCCAEYGTPVNGLGEIQPLLIIGMG
KLGGRELNFSSDIDLIFTYPEAGQTVGGHKTIENSKFFTRLGQRLIKALD
EITVDGFVYRTDMRLRPFGDNGALVLSFAAMEDYYQEQGRDWERYAMIKA
KILGEDLTDVNHRYLQQMLRPFVYRRYLDFSAIQSLREMKQKISREVLRR
NLQDNIKLGAGGIREIEFIVQTFQMIRGGRDKILQQRSLLQVLPHLVTLN
LLTKQQAKHLGDAYIFHRQLENVLQAIDDQQTQSLPADAKNQARIMYACQ
SYWQKDQQNQPLMIEYHWQSWQQFLSTLAQHQQHVRVIFNQLIGEEEQAN
QSPVNEQLAIWQDILHPEIRQLELAEVLRDYPVATEDYATIFHLLANTLQ
DWSKRPIGVRGRKVLSQLMPKVMHSICSKTDYLVVLPRLLNIIDRVTTRT
TYLELLQEKDQILPLLERLCGHSIMVAEQIARYPMLLDEFIINKSLMKVI
EFEQYKTELTEYLIRIPEEDEEALIDALRQFKQGHLLRIAVADILGVLPV
MKISDHLTYLAAAIISEVVNMAWKSLVKRFGKPTHLAEDERGFAVIAYGK
LGGLELGYNSDLDLVFLHNAPLEGETSGRRSISNHQFYLKLAQKINSIFN
LNTSAGVLYEVDMRLRPSGDAGLLVSTFQAYQYYQQHEAWTWETQALVRG
RCVYGSASLIDEFSRIRRTTLCLARTRGRLRQEISQMRHKMYQHLTKTST
GQFNLKTDQGGITDIEFIAQSIVLEYAHCYPEMAKWSDNVRIFTAAIECG
ILSQHIGEGLKNAYTRIRNRIHQLNLLQLPSIVNDTEFVSERAFVTKIWQ
QIFTDNE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTTCTCAACTTGATTTTACCGGCTTACCACTTGCTAATACGGGAGA
AAATAGACCGCTTGCAATCGCAGTGGCTATGTCAAATTTCGTGAAAAAAA
CGCTACAAAAGCAAGCTGATTTACGTGATGATTGGCAACGAAAATTGCCG
ACATTGGCGGATTGTGGCAATTATGCTGAACGGTTAACAATATATTTGTC
AACGATTAACGATGAAGTGCAACTAAGCCATTGTTTGCGTAACTTTAGGC
ACCGTGAAATGGCACGTTTAAGTTTTATTCAGTCAAATAAATTAGCAACG
GTTGAGTTTGTTTTTGAGCAATTATCTGATTTAGCAGAGGCCATAATTCT
TGCCGCGCGAGATTGGTTATTTACCCGTTGTTGTGCAGAATATGGCACGC
CTGTGAATGGTTTAGGTGAAATACAACCCTTATTAATTATTGGTATGGGA
AAATTAGGTGGCAGAGAATTGAACTTCTCTTCAGATATCGATTTAATTTT
TACTTATCCCGAAGCGGGGCAGACGGTAGGCGGTCATAAAACAATTGAAA
ATAGCAAATTTTTTACTCGTTTAGGGCAACGTTTAATTAAAGCATTAGAT
GAAATTACGGTAGATGGTTTTGTTTATCGGACAGATATGCGGCTACGGCC
TTTTGGCGATAATGGCGCATTAGTGCTTAGCTTTGCAGCAATGGAAGATT
ATTATCAAGAACAAGGGCGTGATTGGGAACGCTATGCGATGATCAAAGCG
AAAATTCTTGGCGAAGATTTAACGGATGTGAATCACCGTTACTTGCAACA
AATGTTACGTCCTTTTGTCTATCGCCGTTACCTTGATTTTAGTGCGATTC
AATCTTTACGTGAAATGAAGCAAAAAATTAGTCGAGAAGTATTACGCCGT
AATTTACAGGATAATATTAAATTAGGCGCGGGCGGCATTCGTGAAATTGA
GTTTATTGTACAAACATTCCAAATGATACGGGGTGGGCGGGATAAAATTT
TACAACAACGTAGTTTATTACAAGTGTTGCCACATTTAGTTACGCTTAAT
TTATTGACTAAACAGCAAGCCAAGCATTTAGGTGATGCATATATTTTTCA
TCGACAATTAGAAAATGTTTTACAGGCGATTGATGATCAGCAGACACAAT
CTTTACCGGCTGATGCAAAAAATCAAGCGAGGATAATGTATGCGTGTCAA
TCGTATTGGCAAAAAGATCAACAAAACCAACCGCTTATGATCGAATATCA
TTGGCAATCGTGGCAACAGTTTTTGTCCACGCTAGCGCAACATCAACAGC
ATGTTAGGGTGATTTTTAACCAGCTTATCGGTGAAGAAGAACAAGCGAAT
CAATCGCCGGTCAATGAACAGTTGGCTATTTGGCAAGATATTTTGCACCC
TGAAATTCGCCAACTAGAATTAGCCGAAGTATTACGCGATTATCCGGTGG
CAACTGAAGATTATGCAACGATCTTTCATCTTTTGGCGAATACCTTACAG
GATTGGAGTAAACGACCAATTGGTGTGCGAGGACGCAAAGTGCTTAGTCA
GCTTATGCCTAAAGTTATGCACAGCATTTGTAGTAAAACCGATTATTTAG
TGGTATTGCCACGCCTGCTGAATATTATAGACAGAGTGACTACTCGCACG
ACTTATTTGGAACTATTGCAAGAAAAAGATCAAATTCTACCGCTTTTAGA
ACGGCTTTGTGGCCATTCAATTATGGTCGCCGAACAAATTGCACGCTATC
CGATGTTATTAGATGAATTCATCATCAACAAAAGTTTGATGAAAGTGATT
GAATTTGAACAGTATAAAACCGAGTTAACCGAATATTTAATTCGGATTCC
TGAAGAAGATGAAGAAGCCTTAATAGATGCGTTACGGCAATTTAAGCAAG
GGCATTTATTACGCATTGCGGTTGCTGATATTTTAGGCGTTTTGCCGGTA
ATGAAAATTAGCGATCATCTCACTTATTTAGCGGCAGCAATCATAAGTGA
AGTGGTCAATATGGCGTGGAAATCATTAGTAAAACGTTTTGGCAAACCAA
CTCATTTAGCAGAAGATGAACGAGGTTTTGCCGTGATTGCGTATGGTAAA
TTAGGCGGATTAGAATTGGGCTATAATTCTGACTTAGATCTTGTTTTTTT
ACACAATGCGCCGCTAGAGGGGGAAACAAGCGGTCGAAGATCGATTTCCA
ACCATCAATTTTACTTAAAACTTGCCCAAAAGATTAACTCGATTTTTAAT
TTAAATACTAGCGCAGGCGTATTATATGAAGTAGATATGCGCTTAAGACC
ATCAGGCGATGCCGGCTTGTTGGTCAGTACTTTTCAAGCGTATCAATATT
ATCAACAACATGAAGCTTGGACTTGGGAAACTCAGGCATTAGTTCGTGGC
CGTTGTGTGTATGGTTCAGCTAGCTTAATCGATGAATTTAGTCGAATTCG
GCGTACAACACTTTGTTTAGCGCGTACACGCGGTCGATTACGCCAAGAAA
TTAGCCAAATGCGACATAAAATGTATCAGCATTTAACCAAAACAAGCACA
GGGCAATTCAATTTGAAAACCGATCAAGGTGGCATTACGGATATTGAATT
TATTGCACAAAGTATCGTATTAGAATATGCTCATTGTTATCCGGAAATGG
CGAAGTGGTCAGATAATGTACGTATTTTTACCGCGGCGATTGAATGTGGC
ATTCTGAGTCAACACATTGGTGAAGGCTTAAAGAATGCTTATACCCGCAT
TAGAAATCGGATTCATCAATTGAATTTATTACAATTACCCAGCATAGTTA
ATGATACTGAATTTGTATCAGAAAGAGCATTTGTGACGAAAATTTGGCAA
CAAATTTTTACTGATAATGAATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy