Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR1244 IGR1238 IGR1247 IGR1239 IGR1245 IGR1246 IGR1241 IGR1240 IGR1242 IGR1243 IGR1248 HD1705 greA, - HD1699 HD1698 HD1706 imp, - HD1704 purH, - HD1702 pbp4, - HD1701 HD1697 tpn, - HD1696 pbp4,dacB, - HD1700 gltS, - HD1707 purH, - HD1703 HD1705 greA, - HD1699 HD1698 HD1706 imp, - HD1704 purH, - HD1702 pbp4, - HD1701 HD1697 tpn, - HD1696 pbp4,dacB, - HD1700 gltS, - HD1707 purH, - HD1703 greA, - HD1699 HD1698 HD1706 imp, - HD1704 HD1705 purH, - HD1702 pbp4, - HD1701 HD1697 tpn, - HD1696 pbp4,dacB, - HD1700 gltS, - HD1707 purH, - HD1703 tpn, - HD1695 tpn, - HD1695
* Calculated from Protein Sequence

Gene ID: HD1703

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
purH  

Definition:
phosphoribosylaminoimidazolecarboxamide formyltransferase (bifunctional purine biosynthesis protein)

Gene Start:
1417345

Gene Stop:
1418733

Gene Length:
1389

Molecular Weight*:
50576

pI*:
5.50

Net Charge*:
-9.75

EC:
2.1.2.3  3.5.4.10  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
One carbon pool by folate
Purine metabolism

Secondary Evidence:
Allen S, Zilles JL, Downs DM.
Metabolic Flux in Both the Purine Mononucleotide and Histidine Biosynthetic Pathways Can Influence Synthesis of the
Hydroxymethyl Pyrimidine Moiety of Thiamine in Salmonella enterica.
J Bacteriol. 2002 Nov;184(22):6130-7.
PMID: 12399482

Greasley SE, Horton P, Ramcharan J, Beardsley GP, Benkovic SJ, Wilson IA.
Crystal structure of a bifunctional transformylase and cyclohydrolase enzyme in purine biosynthesis.
Nat Struct Biol. 2001 May;8(5):402-6.
PMID: 11323713

Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to phosphoribosylaminoimidazolecarboxamide formyltransferase protein; i.e. residues 1-462 are 81% similar to (U32770) phosphoribosylaminoimidazolecarboxamide formyltransferase of Haemophilus influenzae, residues 1-462 are 74% similar to (AE000473) phosphoribosylaminoimidazolecarboxamideformyltransferase
of Escherichia coli, residues 1-462 are 75% similar to (AF170176) Salmonella typhimurium phosphoribosylaminoimidazolecarboxamide
formyltransferase and IMP cyclohydrolase of Salmonella typhimurium.

COGS Summary:  COGS Search
BeTs to 7 clades of COG0138
COG name: AICAR transformylase/IMP cyclohydrolase PurH (only IMP cyclohydrolase domain in Aful)
Functional Class:  F
The phylogenetic pattern of COG0138 is a---Yqvcebrh---------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB002695 (AICARFT/IMPCHase bienzyme) with a combined E-value of 9.6e-197.
    IPB002695C    28-41
    IPB002695D    51-83
    IPB002695E    102-124
    IPB002695F    159-172
    IPB002695G    182-197
    IPB002695H    236-265
    IPB002695I    268-294
    IPB002695J    315-325
    IPB002695K    352-390
    IPB002695L    406-440
    IPB002695M    441-462


ProDom Summary:  Protein Domain Search
Residues 403-462 are 88% similar to a (IMP PURINE) protein domain (PD004903) which is seen in PUR9_HAEIN.

Residues 1-66 are 84% similar to a (IMP PURINE BIOSYNTHESIS SYNTHETASE) protein domain (PD002195) which is seen in PUR9_HAEIN.

Residues 67-394 are 81% similar to a (IMP PURINE) protein domain (PD004666) which is seen in PUR9_PASMU.

Residues 403-462 are 50% similar to a (CG11089) protein domain (PD258711) which is seen in Q9VC18_DROME.



Paralogs:  Local Blast Search

HD1703 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 67 to 394 (E-value = 1.1e-200) place HD1703 in the AICARFT_IMPCHas family which is described as AICARFT/IMPCHase bienzyme (PF01808)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LHPKIHGGILGRRGLDDATMQQHNIQPIDMVVVNLYPFAETVARPDCSLA
DAIENIDIGGPTMVRSAAKNHKDVAIVVNNHDFEAILTEMDENANELTLA
TRFNLAIKAFEHTAQYDAMIANYFGQKVPPYQGVEEDLNQVCGQFPRTLN
LNFIRKQTMRYGENAHQNAAFYVENNLQEASVATAKQLQGKVLSYNNIAD
TDAALECVKEFAEPACVIVKHANPCGVALGKDILEAYDRAYQTDPTSAFG
GIIAFNRALDAKTAQAVVDRQFVEVIIAPTVLEEAQLILAQKKNVRVLAC
GEFSVASQRLDFKRVNGGLLVQEADQDIVTLDQLKVVSKRQPTQAELDDL
LFCWKVAKYVKSNAIVYAKNGQTIGIGAGQMSRVYSAKIAGIKAEDEGLQ
VTGCVMASDAFFPFRDGIDAANKVGISCVIQPGGSMRDQEVIDAVNEHGM
AMVLTGMRHFRH$

Gene Nucleotide Sequence:  Sequence Viewer
TTGCATCCTAAAATTCATGGTGGCATTTTAGGGCGTCGAGGCCTAGATGA
TGCAACGATGCAGCAACATAATATTCAACCTATTGATATGGTCGTGGTAA
ATCTTTATCCTTTCGCTGAAACGGTTGCCAGACCTGATTGTAGCTTAGCT
GATGCAATTGAAAATATTGATATTGGCGGGCCGACAATGGTACGCTCTGC
CGCAAAAAATCATAAAGATGTTGCCATTGTCGTAAATAATCATGATTTTG
AGGCGATTCTGACTGAAATGGATGAAAATGCAAATGAACTAACATTAGCA
ACACGTTTCAACTTAGCAATTAAGGCATTTGAACATACCGCACAATATGA
TGCAATGATTGCTAACTATTTTGGTCAAAAAGTACCGCCTTATCAAGGTG
TTGAAGAGGATCTCAACCAAGTATGCGGTCAATTTCCACGCACATTAAAC
CTAAATTTTATTCGTAAACAAACTATGCGCTACGGCGAAAATGCCCATCA
AAATGCGGCATTCTATGTTGAAAATAACTTACAAGAGGCCTCCGTAGCAA
CGGCTAAGCAATTACAAGGTAAAGTACTTTCTTATAATAATATTGCAGAT
ACTGATGCCGCACTCGAATGTGTAAAAGAATTTGCAGAACCGGCCTGTGT
AATTGTTAAGCACGCTAATCCTTGTGGGGTGGCATTAGGCAAAGATATTT
TAGAAGCCTATGATCGGGCTTATCAAACAGATCCGACTTCAGCCTTTGGT
GGTATTATTGCCTTTAACCGTGCATTAGATGCTAAAACTGCACAAGCAGT
TGTAGATCGTCAATTTGTTGAAGTGATTATTGCGCCAACCGTGCTTGAAG
AAGCTCAACTTATTTTAGCCCAAAAGAAAAATGTCCGTGTATTAGCATGC
GGTGAATTTAGTGTTGCTTCACAACGTTTAGACTTCAAACGCGTAAACGG
TGGTTTATTAGTGCAAGAAGCCGATCAAGACATTGTTACATTAGATCAAC
TCAAAGTGGTTTCAAAACGTCAACCTACTCAAGCAGAATTAGATGATTTA
CTCTTTTGCTGGAAAGTCGCTAAATATGTTAAATCAAATGCGATTGTCTA
TGCGAAAAATGGCCAAACGATTGGAATTGGTGCAGGCCAAATGAGTCGAG
TGTATTCTGCCAAAATCGCTGGGATTAAAGCGGAAGATGAAGGCTTACAA
GTGACAGGTTGTGTAATGGCCTCTGATGCATTTTTCCCTTTCCGTGATGG
TATTGATGCAGCAAATAAAGTTGGTATTAGTTGTGTTATTCAACCGGGTG
GTTCAATGCGCGATCAAGAAGTGATTGATGCAGTAAATGAACACGGTATG
GCTATGGTCTTAACAGGTATGCGTCATTTCCGCCATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy